KEGG   Endosymbiont of unidentified scaly snail isolate Monju: EBS_0699Help
Entry
EBS_0699          CDS       T04530                                 

Definition
(GenBank) ribulose-bisphosphate carboxylase large chain
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
enm  Endosymbiont of unidentified scaly snail isolate Monju
Pathway
enm00630  Glyoxylate and dicarboxylate metabolism
enm01100  Metabolic pathways
enm01110  Biosynthesis of secondary metabolites
enm01120  Microbial metabolism in diverse environments
enm01130  Biosynthesis of antibiotics
enm01200  Carbon metabolism
Module
enm_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:enm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    EBS_0699
Enzymes [BR:enm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     EBS_0699
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: BAN68648
UniProt: S6BBB2
Position
complement(763403..764797)
Genome map
AA seq 464 aa AA seqDB search
MALDQSSRYSDLSLKEEDLIAGGRHILCAYKMKPKAGHGYLEAAAHFAAESSTGTNVEVC
TTDEFTKGVDALVYHIDEANEDMRIAYPIELFDRNITDGRMMMVSFLTLTIGNNQGMGDI
EYAKMIDFYMPKRAIELFDGPAKDISDLWRILGRPIVDGGYIAGTIIKPKLGLRPEPFAE
AAYQFWLGGDFIKNDEPQGNQVFAPLKKVIPLVADAMKRAQDETGEAKLFSANITADDHS
EMIARGEYILETFGEFADHVAFLVDGYVGGPGMITTARRWFPNQYLHYHRAGHGAVTSPS
SKRGYTAFVLAKMSRLQGASGIHVGTMGYGKMEGDADDRVIAYMIERDSVDGPVYHQEWY
GMKPTTPIISGGMNALRLPGFFENLGHGNVINTAGGGSYGHIDSPAAGAISLRQAYECWK
AGADPIEWAKEHKEFARAFESFPHDADALYPGWREKLGVSAAHK
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atggctctcgatcaatccagtcgctattccgacctcagcctgaaggaagaggatctcatc
gccggcgggcggcacattctgtgcgcctacaagatgaagcccaaggccggccatggctac
ctggaagctgccgcgcacttcgccgccgaatcctccaccggcaccaacgtcgaagtctgc
accaccgacgaattcaccaagggcgtggacgcactggtgtaccacatcgatgaagccaac
gaggacatgcgcattgcctatccgatcgaactgttcgaccggaacatcaccgacggccgc
atgatgatggtctccttcctcaccctgaccatcggcaacaaccagggcatgggcgacatc
gagtacgccaagatgatcgacttctacatgcccaagcgcgccatcgaactgttcgacggc
ccggccaaggacatctccgacctgtggcgcatcctcggccgccccatcgtcgacggcggc
tacatcgccggcaccatcatcaagcccaagctgggcctgcgccccgaacccttcgccgag
gcggcctaccagttctggctgggcggtgacttcatcaagaacgacgagccccagggcaac
caggtgttcgctcccctgaagaaggtcatcccgctggtcgccgatgccatgaagcgcgcc
caggacgagactggcgaggccaagctgttctcggccaacatcactgccgacgaccattcg
gaaatgattgcccgcggcgagtacatcctcgagaccttcggcgagttcgccgaccacgtc
gccttcctggtggacggctacgtcggtggtccgggcatgatcaccaccgcccgccgctgg
ttccccaaccagtacctgcactatcaccgtgccggtcacggcgccgtgacctcgcccagc
tccaagcgcggctacaccgccttcgtgctggccaagatgtcgcgtctgcagggggcctcg
ggcatccacgtcggcaccatgggctacggcaagatggaaggtgacgccgacgaccgcgtc
atcgcctacatgatcgagcgcgacagcgtggacggtccggtgtatcaccaggagtggtac
ggcatgaagccgaccaccccgatcatctccggcggcatgaacgcactgcgtctgcccggt
ttcttcgagaacctgggccacggcaacgtcatcaacactgctggcggtggctcctacggc
cacatcgacagcccggcggctggcgcgatctccctgcgccaggcctacgagtgctggaag
gccggcgccgatcccatcgaatgggccaaggagcacaaggaattcgcccgtgccttcgaa
tccttcccgcacgatgccgacgccctgtacccgggctggcgcgagaagctgggcgtgagc
gccgctcacaagtaa

DBGET integrated database retrieval system