KEGG   Endosymbiont of unidentified scaly snail isolate Monju: EBS_1710Help
Entry
EBS_1710          CDS       T04530                                 

Gene name
atoB
Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
enm  Endosymbiont of unidentified scaly snail isolate Monju
Pathway
enm00071  Fatty acid degradation
enm00280  Valine, leucine and isoleucine degradation
enm00310  Lysine degradation
enm00362  Benzoate degradation
enm00380  Tryptophan metabolism
enm00620  Pyruvate metabolism
enm00630  Glyoxylate and dicarboxylate metabolism
enm00640  Propanoate metabolism
enm00650  Butanoate metabolism
enm00900  Terpenoid backbone biosynthesis
enm01100  Metabolic pathways
enm01110  Biosynthesis of secondary metabolites
enm01120  Microbial metabolism in diverse environments
enm01130  Biosynthesis of antibiotics
enm01200  Carbon metabolism
enm01212  Fatty acid metabolism
enm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:enm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    EBS_1710 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    EBS_1710 (atoB)
   00640 Propanoate metabolism
    EBS_1710 (atoB)
   00650 Butanoate metabolism
    EBS_1710 (atoB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    EBS_1710 (atoB)
   00072 Synthesis and degradation of ketone bodies
    EBS_1710 (atoB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    EBS_1710 (atoB)
   00310 Lysine degradation
    EBS_1710 (atoB)
   00380 Tryptophan metabolism
    EBS_1710 (atoB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    EBS_1710 (atoB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    EBS_1710 (atoB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    EBS_1710 (atoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:enm04147]
    EBS_1710 (atoB)
Enzymes [BR:enm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     EBS_1710 (atoB)
Exosome [BR:enm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   EBS_1710 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C
Motif
Other DBs
NCBI-ProteinID: BAN69586
UniProt: S6BKA7
Position
complement(1855203..1856381)
Genome map
AA seq 392 aa AA seqDB search
MKAVYILSAVRTAIGRFGGSLRDVPPAELLTPVMRAAIERSGLPAGRLETAILGNVLHTA
PGDPYLARRCSIEAGQPQAATALAINRLCGSSLEAIIDLGMRIRLGEVRAGIAAGVESMS
RAPHVLPDLRFGRKLGDVGLLDMLPGPLTDPFGHGHMGETAEYLAEHFGIDRETMDAFAL
DSQRKALAAIEAGRFEGQIVPIEVGPPGRRHAFARDEHPRADVTPERLAALPPAFREGGR
VTAGNSSGINDAASALVLADEDAVAGLRPMARVLAWGHAGTDPRLMGIGPVGASRQALQR
AGLEADDLDVVESNEAFAAQACAVSRELGLDAAIVNPNGGAIALGHPIGATGAILVTKLV
RELARRGGRYGLATLCIGGGQGAALVVENLLR
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcggtttacatcctctctgcggtgcgcaccgctatcggccgcttcggcggcagc
ctgcgcgatgtgccgccggccgagttgctcaccccggtgatgcgggccgccatcgaacgc
tcggggctgccggccgggcggctggagacggccatcctgggcaatgtgctgcacaccgcg
cccggtgatccctacctggcgcgtcgttgctcgatcgaggccggccagccgcaggcggcc
accgcgttggcgatcaaccggctgtgcggcagctcgctggaggcaatcatcgatctgggc
atgcggatccgccttggcgaagtccgtgccggcattgccgcgggggtggagtcgatgagc
cgcgcgccccatgtactgccggacttgcggttcggcaggaagctcggggacgtgggcctg
ctcgacatgcttcccgggccgctgaccgatccgttcggccacggtcacatgggcgagacg
gccgagtacctggccgaacacttcggtatcgaccgcgagaccatggacgccttcgcactg
gattcccagcgcaaggcgctcgcggccatcgaggccggtcgtttcgaggggcagatcgtg
ccgatcgaggtgggccccccggggcggcgccacgcgttcgcacgcgacgagcatccgcgt
gccgacgtcacgcccgaacggctggccgccctgccgccggccttccgtgaaggggggcgg
gtgacggccggcaacagttcggggatcaacgacgcggccagcgccctggtgctggccgat
gaggacgcggtggccgggctgcggcccatggcccgggtgcttgcctgggggcatgcgggt
accgatccccggctgatgggcatcgggccggtcggcgccagccgccaggccttgcagcgt
gccggcctggaggcggacgacctggatgtcgtcgagtcgaacgaggcattcgccgcccag
gcctgtgcggtcagccgtgagctggggctggatgccgccatcgtcaatccgaatggcggc
gcgattgcgctgggacacccgatcggcgccaccggcgccatcctcgtcaccaagctggtg
cgtgaactggcacgccgcggcggtcgttacggcctggccacgctctgtatcggcggcggc
cagggggcggcgctggtggtcgagaatctgttgcgctga

DBGET integrated database retrieval system