KEGG   Endosymbiont of unidentified scaly snail isolate Monju: EBS_2052Help
Entry
EBS_2052          CDS       T04530                                 

Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
enm  Endosymbiont of unidentified scaly snail isolate Monju
Pathway
enm00860  Porphyrin and chlorophyll metabolism
enm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:enm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    EBS_2052
Enzymes [BR:enm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     EBS_2052
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: BAN69911
UniProt: S6BLK6
Position
2228839..2229447
Genome map
AA seq 202 aa AA seqDB search
MSTTLLDYLRHGLPEGGSRYRGHGVDDPLSETGWTQMRATPAALGGWQVVVSSPLTRCAA
FAQWLAETHDLPLLIDEDLREVGLGDWEGRTRAELQAERADEYHACYADPVHNRPAGAEP
LEAFGTRVATAFQRIAARHAGQRVLVVAHAGVIRATLGHVLAAPPANWYRAAVDNAAISR
FAHDGESARLVWHNWRPPEASS
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccactcttctcgactacctgcgccatggcctcccggagggcggcagccgctac
cgtggccacggtgtcgacgacccgttgagcgagaccggctggacccagatgcgcgccacc
cccgctgcgctcggcggctggcaggtggtggtcagctcgccgctgacccgctgcgcagcc
ttcgcgcaatggctggccgagacgcacgacctgcccctgctcatcgacgaggacctgcgc
gaagtcggcctgggcgactgggaaggccgcacccgcgccgagttgcaggccgagcgcgcc
gacgagtaccacgcatgctacgcagacccggtgcacaaccgtcccgccggcgccgaacca
ctggaggccttcggcacccgggtggccacggccttccagcgcattgctgcccgccatgct
ggacaacgggtgctggtggtcgcgcacgccggggtgatccgcgccaccctggggcatgtg
ctcgccgccccacccgccaactggtatcgtgccgcggtggacaatgccgcgatcagccgc
ttcgctcacgatggcgaaagcgcaaggctggtctggcacaactggcgcccaccggaggcc
tcctcgtga

DBGET integrated database retrieval system