KEGG   Endosymbiont of unidentified scaly snail isolate Monju: EBS_2149Help
Entry
EBS_2149          CDS       T04530                                 

Gene name
aprB
Definition
(GenBank) adenylylsulfate reductase, subunit B
  KO
K00395  adenylylsulfate reductase, subunit B [EC:1.8.99.2]
Organism
enm  Endosymbiont of unidentified scaly snail isolate Monju
Pathway
enm00920  Sulfur metabolism
enm01100  Metabolic pathways
enm01120  Microbial metabolism in diverse environments
Module
enm_M00596  Dissimilatory sulfate reduction, sulfate => H2S
Brite
KEGG Orthology (KO) [BR:enm00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    EBS_2149 (aprB)
Enzymes [BR:enm01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.99  With unknown physiological acceptors
    1.8.99.2  adenylyl-sulfate reductase
     EBS_2149 (aprB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: APS-reductase_C Fer4_9 Fer4_7 Fer4 Fer4_16 Fer4_4 Fer4_10 Fer4_3 Fer4_2 Fer4_6 Fer4_18 Fer4_8
Motif
Other DBs
NCBI-ProteinID: BAN70000
UniProt: S6CGX1
Position
complement(2329523..2329996)
Genome map
AA seq 157 aa AA seqDB search
MPTFVRTDKCDGCKGQDKTACMYICPHDLMKLDMDGSETGHAMKSYNQEPEQCWECYSCI
KICPQNAIEARPYADIVPLGASVQPLRGTDSIMWTIKFRNGTMKRFKFPIRTTPEGSIDP
YGGKPKADLSKIAEPGFFNHNEQNGYRAGDPSELICK
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgcctacattcgtacgtaccgacaagtgcgatggctgtaaaggccaggacaagaccgcg
tgcatgtacatctgcccgcacgatctgatgaaactggacatggacggctcggagaccggc
cacgccatgaagtcctacaaccaggagccggagcagtgctgggagtgctactcctgcatc
aagatctgcccgcagaacgccatcgaggcacgtccctacgctgacatcgtgccgctgggt
gcctccgtgcagccgctgcgtggtaccgattccatcatgtggaccatcaagttccgcaac
ggcaccatgaagcgcttcaagttccccatccgcaccaccccggaaggctccatcgatccg
tacggcggcaagcccaaagccgacctgagcaagatcgccgagccgggtttcttcaaccac
aacgagcagaacggctaccgcgccggcgacccgagcgagctgatctgcaagtga

DBGET integrated database retrieval system