KEGG   Euhalothece natronophila: FRE64_00040Help
Entry
FRE64_00040       CDS       T06117                                 

Definition
(GenBank) UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
enn  Euhalothece natronophila
Pathway
enn00471  D-Glutamine and D-glutamate metabolism
enn00550  Peptidoglycan biosynthesis
enn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:enn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    FRE64_00040
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    FRE64_00040
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:enn01011]
    FRE64_00040
Enzymes [BR:enn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     FRE64_00040
Peptidoglycan biosynthesis and degradation proteins [BR:enn01011]
 Precursor biosynthesis
  Amino acid ligase
   FRE64_00040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C AlaDh_PNT_C TrkA_N IlvN NAD_binding_2 Shikimate_DH Pyr_redox 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: QDZ38473
UniProt: A0A5B8NH41
Position
7616..8968
Genome map
AA seq 450 aa AA seqDB search
MKAYVIGLGRSGIAAARVLKKQGWEVIISDRNLTPSLQETQRRLAQEGITVKLNDTPTIE
EVKTVDTIIASPGVPWDIPLLVRAREYNIPVYGEIELAWRSLKDIPWVGISGTNGKTTTT
ALCAALFQGSGLNAPACGNIGDAACELCLKDSSWDWIIAEISSYQIESSQQLAPEIGIWT
TFSPDHLERHYTLENYFQIKKSLLDRAHFKIINGDDPYLRSLAEENWSNVHWTSIKGLEG
LIGEPSQGIYIEDGEVIAYGEKIINVSDFPMVGDHNLQNLLLAIGAARLAGLDKSAIAQS
IINFKGVPHRLEPVCEINGVSFINDSKATNYEAAWVGLSSVSSPVILIAGGQAKTGNDEE
WFNLIKEKAQAVLLIGEASSKFAQRLEEIGYQAYQEVETMNNAVKTAVKMAEKKQGSVVL
FSPACASFDQYDNFEQRGDHFRKLCLSHHS
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcatacgtaattggtttaggacgctctggaattgcggctgcccgtgtcttaaaa
aagcaaggttgggaagtaataatcagcgatcgcaacctcactccctctctccaagaaact
cagcgtcgcctagcacaagaagggattactgtcaaactcaatgatactcccacgattgag
gaagtaaaaaccgttgacacgattattgctagtcctggtgttccttgggatattcccctg
ttagtccgcgcccgtgaatacaatattcctgtttatggggaaattgaattggcctggcgt
agtttaaaggatattccttgggtgggcattagcggaactaatggtaaaaccaccacaact
gctctttgtgcggcattatttcaaggcagtggcttaaatgcccctgcttgtggcaatatt
ggggacgctgcctgtgagttgtgcttaaaagatagcagttgggattggattattgctgaa
attagtagttatcaaattgaatcatcgcaacaacttgccccagagattggcatttggaca
acgtttagccccgatcatctcgaacgtcactacacccttgaaaattattttcaaatcaaa
aaatcactgctcgatcgcgctcactttaagattattaatggcgatgatccctatctccgc
agtttagcagaagaaaattggtcaaatgtgcattggacaagtattaaagggttagaggga
ttaattggtgaacccagtcaaggcatttatattgaagacggggaagttattgcctatggg
gaaaaaatcattaatgttagtgactttcccatggtgggggatcataatctacaaaattta
ctattagccattggcgcagcccgtttagcaggattagacaaaagcgcgatcgcgcaaagt
attattaattttaagggcgttccccatcgcctcgaacccgtttgcgaaattaacggagtc
tcctttattaacgacagcaaagccactaattatgaagctgcgtgggtgggattatcttcc
gtttccagtcctgttattctcattgcaggagggcaagccaaaaccggtaacgatgaggaa
tggtttaatcttattaaagaaaaagcccaagctgtgttactcattggagaagcttcttct
aagtttgctcaacgcttagaggaaattggatatcaggcttatcaggaagtagaaaccatg
aataatgctgttaagactgccgttaaaatggccgagaaaaaacagggttctgtggtgtta
ttttctcccgcttgtgccagttttgatcaatatgacaactttgaacagcgcggtgatcat
tttcggaaattgtgtttaagccatcactcgtaa

DBGET integrated database retrieval system