KEGG   Euhalothece natronophila: FRE64_05030
Entry
FRE64_05030       CDS       T06117                                 

Definition
(GenBank) prohibitin family protein
Organism
enn  Euhalothece natronophila
SSDB
Motif
Pfam: Band_7
Other DBs
NCBI-ProteinID: QDZ39346
UniProt: A0A5B8NK42
Position
complement(1067717..1068685)
AA seq 322 aa
MTQPNTQSLRAIIGGILAALLLIIGFNSYTVINPGEAGVLSILGQAQEGALLEGIHFKPP
IISKVDVYDVTVQKYEVPAQSATKDLQDLNASFAINFRLDPVQVVDIRRKQGTLSNVVAK
VISPQTQESFKVAAARKTAEEAITRRDELKRDFDVALNSRLEKYGIIVLDTSVVDLNFTK
AFAQAVEDKQIAEQSAQRAVYIAREAEQKAQADINRAKGRAEAQRLLADTLRAQGGSLVL
QKEAIEAWRQGGSQMPNVLVMGGDNKSSVPFLFNLGDLTDVDRDRPSPEEAAPLDEPSPF
EENNSGESSSSLDLPPTYGDLQ
NT seq 969 nt   +upstreamnt  +downstreamnt
ttgactcaaccgaatactcaaagtttaagggcgattataggtggcattctcgctgcctta
ctgttaatcattggttttaattcttatactgtgattaaccccggagaagcaggagtttta
agcattttaggacaagcccaagaaggggctttactagaaggcatccattttaagcctccg
attatttctaaggtggatgtgtatgatgtcacagtacagaaatatgaagttcccgcccaa
agtgcgacgaaagacttacaagacttaaatgcgagttttgcgattaacttccgtcttgat
cctgtgcaagtggtggatattcgccgtaagcaaggaactttaagtaatgttgtggcgaaa
gtgatttctccgcaaactcaagaatcatttaaagttgccgctgccagaaaaaccgcagaa
gaagccattactagacgggatgagttaaaacgagattttgatgtggctctcaatagtcgt
ttagaaaagtatggcattattgttttagataccagcgtggttgatctaaactttaccaaa
gcctttgctcaagcagtggaagataaacaaattgctgaacaaagtgcccaacgagccgtt
tatattgcccgagaagccgaacagaaggctcaagcagatattaatcgtgctaaagggcgt
gctgaagctcaacgcctcctcgcagatactttacgcgctcaagggggatcactggtactg
caaaaagaagccattgaagcgtggcgacaaggtggctctcaaatgcccaatgttttagtg
atgggcggtgacaacaagagtagtgttcctttcttgtttaatttaggtgatttaacagat
gtggatcgcgatcggccctcaccagaagaagcagcacctttagatgagccgtctcctttt
gaagaaaataacagtggcgagtcttcatcatctcttgatcttcctcctacttatggggat
cttcagtag

DBGET integrated database retrieval system