KEGG   Euhalothece natronophila: FRE64_07060Help
Entry
FRE64_07060       CDS       T06117                                 

Definition
(GenBank) form I ribulose bisphosphate carboxylase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
enn  Euhalothece natronophila
Pathway
enn00630  Glyoxylate and dicarboxylate metabolism
enn00710  Carbon fixation in photosynthetic organisms
enn01100  Metabolic pathways
enn01110  Biosynthesis of secondary metabolites
enn01120  Microbial metabolism in diverse environments
enn01130  Biosynthesis of antibiotics
enn01200  Carbon metabolism
Module
enn_M00165  Reductive pentose phosphate cycle (Calvin cycle)
enn_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
enn_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:enn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    FRE64_07060
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    FRE64_07060
Enzymes [BR:enn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     FRE64_07060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: QDZ39716
UniProt: A0A5B8NL38
Position
1471281..1472702
Genome map
AA seq 473 aa AA seqDB search
MAQTKQASSGFKAGVQDYALTYYTPDYTPKDTDILAAFRVTAQPGVPPEEAGAAVAAESS
TGTWTTVWTDHLTDLDRYKGRCYEIESIPGEENQFFAFVAYPLDLFEEGSVTNLLTSIVG
NVFGFKALRALRLEDLRIPVAYLKTFQGPPHGITVERDLLNKYGRPLLGCTIKPKLGLSA
KNYGRAAYECLRGGLDFTKDDENINSQPFMRWRDRFLFIAEAVHKAQAETNEIKGHYLNV
TASTCDEMLKRAEFVKELEMPILMHDYLTGGFTANTTLAKWCRDNGVLMHIHRAMHAVID
RQKNHGIHFRVLAKCLRMSGGDHLHSGTVVGKLEGERDITLGFVDQMREDHVEEDRSRGN
FFTQDWASMGGVMPVASGGIHIWHMPALVDIFGDDSCLQFGGGTLGHPWGNAPGATANRV
ALEACIQARNEGRNLAREGSDIIKEAARWSPELKVASELWKEIKFEYEAVDTI
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atggcacaaacaaaacaagcatcgagtggttttaaagctggggtacaagattatgcccta
acttactacactcccgattacacccctaaagatactgatattttagccgcgttccgagta
acagcccagccaggagttcctcctgaagaagcaggggcagcggttgccgctgaatcttcc
acaggaacttggacaacagtttggacagaccatctcaccgatttagaccggtataaagga
cgttgctacgagattgagtcaattccaggtgaagaaaatcagttctttgcttttgtcgcc
tatccccttgacttatttgaagaaggatccgttactaacttattaacctctattgttggg
aacgtctttggctttaaagcattacgcgcccttcgtttagaagacttgcggattcctgta
gcttatctcaaaacattccaagggcctcctcatggcatcaccgtagaacgggatcttctc
aataaatatggtcgtcccttactcggttgcaccattaagcccaaattaggactatccgct
aaaaactatggtcgcgcagcttatgagtgtcttcgtggtggcttagacttcaccaaagat
gacgaaaacattaactcacagccctttatgcggtggcgcgatcgtttcctctttattgcg
gaagcggttcataaagcccaagctgaaaccaacgaaattaaaggtcactatctcaatgtc
actgcctctacctgtgatgagatgctcaagcgtgccgaattcgtcaaagaattagagatg
cccattctgatgcacgattatctcactggtggctttaccgcaaacaccaccttagcgaaa
tggtgtcgtgataatggcgttctcatgcacatccaccgcgcgatgcacgctgttattgac
cgtcagaaaaatcatgggattcacttccgtgtgctggcaaaatgcttacggatgtctggt
ggcgatcacctccactcaggaactgttgttgggaagttagaaggtgagcgcgatattacc
ttaggtttcgtggatcaaatgcgcgaagatcacgtggaagaagatcgctctcgtggtaac
ttctttactcaagactgggcttccatgggaggagtcatgcctgttgcttctggcgggatt
cacatttggcatatgccagcgttggttgatatctttggagatgattcctgcttacagttt
ggtggcggaacgttaggacacccttggggaaatgcccccggtgcgacagcgaaccgtgtt
gctctagaagcctgtattcaagctcgtaatgaaggtcgtaaccttgctcgtgaaggtagc
gatattatcaaagaagcagcacgctggtcacctgaactgaaagttgcttccgaactctgg
aaagaaattaagttcgagtacgaagcagtggatactatctag

DBGET integrated database retrieval system