KEGG   Euhalothece natronophila: FRE64_09235Help
Entry
FRE64_09235       CDS       T06117                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
enn  Euhalothece natronophila
Pathway
enn03010  Ribosome
Brite
KEGG Orthology (KO) [BR:enn00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    FRE64_09235
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:enn03011]
    FRE64_09235
Ribosome [BR:enn03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    FRE64_09235
  Bacteria
    FRE64_09235
  Archaea
    FRE64_09235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 HTH_Tnp_ISL3
Motif
Other DBs
NCBI-ProteinID: QDZ40111
Position
1922711..1923070
Genome map
AA seq 119 aa AA seqDB search
MAVDTTTETKAIARYIRMSPHKVRRVLDQIRGRSYREALIILEFMPYRACDPVLKVLRSA
AANAEHNEGLDRANLVISQAYADQGPALRRFRPRAQGRAYQIRKPTCHITIAVATTVEN
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atggctgttgatacaaccacagaaaccaaagcgatcgcgcgttacatccgaatgtctccc
cataaagtgcgacgggtactcgatcaaattcgcggtcggtcttaccgagaagcattaatc
atccttgaatttatgccctatcgcgcctgtgaccccgttttaaaggtgttgcgttctgcg
gctgccaatgccgaacataacgaagggctcgatcgcgcaaaccttgtcattagccaagcc
tatgcggatcaagggccagcattaagacgatttcgtccccgcgcccaaggtcgagcgtat
caaattcgcaaacccacctgtcacatcaccatcgccgtcgccactactgtagaaaactaa

DBGET integrated database retrieval system