KEGG   Enterobacter cloacae subsp. cloacae ENHKU01: ECENHK_11295Help
Entry
ECENHK_11295      CDS       T02315                                 

Definition
(GenBank) sucrose-6-phosphate hydrolase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
eno  Enterobacter cloacae subsp. cloacae ENHKU01
Pathway
eno00052  Galactose metabolism
eno00500  Starch and sucrose metabolism
eno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    ECENHK_11295
   00500 Starch and sucrose metabolism
    ECENHK_11295
Enzymes [BR:eno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     ECENHK_11295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43 Reg_prop
Motif
Other DBs
NCBI-ProteinID: AFP70124
Position
complement(2418534..2419940)
Genome map
AA seq 468 aa AA seqDB search
MTLPSRWPAILQAVMKGQPRAQADSHYPQWHAAPVTGLMNDPNGFIWFAGRYHLFYQWNP
LDCEHRFKCWGHWSSADLVHWQHEPLALMPDEEYDRNGCYSGSAVDNQGVLTLCYTGNVK
FDDGSRTAWQCLAEEQPDGTFKKQGPVLALPEGYTGHVRDPKVWQHDGLWYMVLGAQDLQ
KRGKVLLFKSADLHAWASCGEIAGHGVNGLKDAGYMWECPDLFALDGTHVLICCPQGLAR
EPYRYLNTYPAAWMSGAFSYERGTFAHGELHELDAGFEFYAPQTTLAEDGRRILIGWMGV
PDGEEMLQPTRSHGWMHQMTCPRELQYRDGKLWQTPVRELAALREEEQHWQGRASDAPVL
DAARLEFELSASQVNVDFAGALRLTVDEQGVRLERASLKTGETLTRYWQGDVHHLRVLCD
RSSVEIFINHGEGVMSSRYFPDHPAWVRFEGASDITLRYWSLRACMIE
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgacgttaccttcccgctggcctgcgattctgcaggccgttatgaaagggcagccgcgc
gcgcaggctgacagccattatccgcaatggcacgccgcgccggtgacggggctgatgaac
gatcccaacgggtttatctggtttgccggtcgctaccatctgttctatcagtggaatccg
ctggactgtgagcatcgttttaaatgctgggggcactggagttctgcggacctggtccac
tggcagcatgagccgctggcgctgatgcccgacgaagagtatgaccgcaacggctgctac
tccggtagcgccgtggataaccagggcgtgctgacgctgtgctataccggcaacgtgaag
ttcgatgacggcagccgtaccgcctggcagtgcctggccgaggaacagccggacggcacc
tttaaaaagcaggggccggtgctggcgctgccggagggctacaccggtcatgtgcgtgac
ccgaaagtgtggcaacacgacgggctgtggtacatggtgctgggcgcgcaggatctgcaa
aagcgcggcaaagtgctgctgtttaaatccgctgatttacatgcctgggcttcctgcggt
gaaatcgctggtcacggggtcaacggcctgaaggacgcaggttatatgtgggagtgcccg
gacctgttcgcgctcgacggtacgcacgtgttgatttgctgtccgcaggggctggcgcgc
gagccttatcgctatctcaacacctatccggccgcctggatgagtggggcgtttagctat
gaacgcggcacgtttgcgcacggcgagctgcacgagcttgacgcgggctttgagttttac
gccccgcaaacgacgctggcggaagatggacgacgcattctgattggctggatgggcgta
ccggacggggaagagatgcttcagccgacgcggtcgcacggctggatgcaccagatgacc
tgcccgcgcgaattgcagtatcgcgacggcaagctctggcagactccggtgcgtgagctg
gcggcgctgcgtgaagaggagcagcactggcagggacgtgccagcgatgcgcccgttctg
gatgccgcgcgactggagtttgagttaagcgcctcgcaggtgaacgtcgattttgcgggc
gcgctgcgcctcacggttgatgagcagggcgtgcggctggaacgcgcaagcctgaaaacc
ggtgagacgttgacccgctactggcagggggacgtccaccatttacgcgtcctgtgcgac
cgctccagcgttgaaattttcatcaatcatggcgaaggggtgatgagcagccgctatttt
cctgaccatccggcctgggtgcgcttcgaaggtgcgtccgatatcacattacgctactgg
tcgctgcgcgcctgcatgatagaatga

DBGET integrated database retrieval system