KEGG   Enterobacter kobei ENHKU01: ECENHK_13095
Entry
ECENHK_13095      CDS       T02315                                 

Definition
(GenBank) RhsB
Organism
eno  Enterobacter kobei ENHKU01
SSDB
Motif
Pfam: RHS_repeat RHS PAAR_motif DUF4150
Other DBs
NCBI-ProteinID: AFP70472
UniProt: A0A2J0PII1
Position
complement(2771675..2776150)
AA seq 1491 aa
MSDNNAARKGDEIIHSSIFADITSIVAEGAAYAVIGAAVGAAATVAAPLLGAGAAAAGVA
AIGSSCLLSGIIGGVLANVAGITDDISNAAEGLGNALFPPSPAGKITTGSNNVLTNAIPA
ARAAGTLTPADTPSPEPQSPGSFADYAGMLLSAAGQFGSEMWQPSVASAAAGTSPLEEDK
VACEKHSGPQYLAEGSKSVFINGQPAVRAKDRTTCEGTISDDVSPNVIIGGDTLTVRDIK
SGKTPGLALGMIALSLLRGRPGKILKNMPCALAAAGGGMLADMAVNAVFGSSHPVHAATG
VKVLNDDDELDFSLPGRFPLRWQRSYNSLTTREGLFGLGWATPFDSYLTLEENNATWFDE
TGRELSFELPPVDRAFYSISEGIIIRRNENGDVAIADDDGAVWRLYKPTRANPAVLRLAS
LSDEYGNALLTTWDEHGRLVGLHDEPRAIDVTLRYEDERFPQRVTSASHFDGNRSWPLMQ
WRYDAGGQLASATDASGVVTREYRYNDRGLMVWHRLPGGLESEYRWQKFDHWRVVENRTS
TGDGCRFSYDLAAGLTTVEHYDGQTRKHYWNAQNLIVRYVDERGENWRYEWDDNELLTRR
VDPLGNAVTFVYDEMGNRVQEIDADGNTRTTTWLEHRALPAAIIEADGSATRFWYDEHHG
LKRVVDPMGQTTLLHRDEFGQVVEEVDAAGNSRYQEYNDAGQMVRATDCSGRITRYRYHP
LGWLVAETGADGEETRYRYDAAGRPVQLDRPEGWTESLAWNERGLPVKHAGADGKESEFR
YDDAGRLTATRNTQGEEVRRRWDSRGRLVALENENGEAYRFRWGADSLLLEETGLDGVAS
QYRYDACGRTIARTFAAGHPEAITHAFAWSASGQLVARTTPEGQTRYHYTPSGLLSRIGL
HPELSADAWTTEAEQELAFDYDALGRVTREAGEHGELAWEYDALGNRTSLTLPDGRELKQ
FYYGSGHLLGIALDKLSVSDFTRDELHRETSRTQGLLTTRSEYDRLGRLHRRDVFTGNAQ
RPSPRRWSRRWDYDYRNNLVREERDDNPFSWYRWQYDSAGRLLVQDGSLPGQEQWRWDAA
GNPLEDSAEKVTHNRLTQLNGIRWRYDIHGRTVEKDNGQTRWHYRYDGEHRLTEVISQPR
DRNKPQTQVNFRYDPLGRRISKTRRQMLGGQPTGKPVTTRFVWEGFRLLQELHGDVPLTY
VYSDQDSYDPLARIDGVVAPEIFWFHCQPNGTPERMTDIEGQVRWDAVNSAWGKLLRESE
TQVSGYSQNLRMQGQYLDRETGLHYNLFRYYDPDCGRFTQQDPIGLAGGINLYQYAPNAL
GWVDPWGLSRECSGKTKPDFYVGPAGPSATMPSTAYRYVRYLNDDGSLDKWAPGLLETKK
APVTYFGFEKFETGKAARDAFQIKGPDKVDPTLPADVSWSDARIRGTFDTLQLYENGTPQ
VRHPRMFGDEIGAPLEQFTHAYPQYGKGGVEQMHAEKRTIIFDKIDILPEE
NT seq 4476 nt   +upstreamnt  +downstreamnt
atgagcgataacaacgcggcccgtaagggcgacgagattattcactccagcatttttgct
gacatcaccagcattgtggcggaaggtgccgcctatgcggtgatcggtgcggcggttggc
gctgctgcaaccgtagcggcgccactgctgggggcgggggccgcggcagcaggcgtggcg
gcaattggatccagctgtctgttaagcgggattatcggcggcgtgctggcgaacgtggca
gggatcactgacgatatcagcaatgccgcggaagggttgggcaatgcgcttttccctccg
tcgcctgcgggcaaaattaccaccggttcgaataacgttctgacgaatgcgatccccgcc
gcgcgcgcggccggaacgctgacgcctgcggataccccttcccctgaaccgcagtctccg
ggcagttttgccgattacgcagggatgctgctttccgccgccggacaatttggcagcgaa
atgtggcagccgagcgtggcctctgccgcggcggggacctcgccactggaagaagacaag
gtggcgtgcgaaaaacactccgggccgcagtatctggcggaaggctccaaaagcgtcttt
atcaacggacagcctgcggtgcgcgcgaaagatcgcaccacctgcgaaggcaccatttcc
gacgatgtctccccgaacgtgatcattggcggcgacacgcttacggttcgcgatatcaaa
agcggtaaaacgccgggactggcgctggggatgattgcgctctccctgctgcgcggacgt
ccgggcaagattctgaaaaacatgccctgcgcgctggcggcggccggcggcgggatgctg
gccgatatggccgtgaatgccgtgtttggctcctcgcatccggttcacgccgccaccggc
gtaaaggtactgaatgacgacgatgaactcgatttctcgctgccgggacgcttcccgctt
cgctggcagcgcagctataacagcctgaccacccgcgaagggctgttcgggctgggctgg
gcaaccccctttgacagctatctgacgctggaagaaaacaacgccacctggttcgacgaa
accgggcgtgagctgagcttcgagctgccgcctgtcgaccgcgcgttttacagcatcagc
gaaggcatcattatccgccgtaatgaaaatggcgacgtggcgatagctgatgacgacggt
gcggtgtggcgtctgtacaaaccaacccgggcaaaccctgctgttctgcgtctggcatct
ctcagcgacgaatacggcaacgcgctgctgacgacgtgggatgagcacggcaggctggtt
ggtcttcacgacgagccacgggcaatagatgttactttgcgctatgaagatgaacgtttc
ccgcagcgcgtgacgtcggcgagccatttcgatggcaaccgttcctggccgctgatgcag
tggcgctacgatgcgggcggccaactggcgagcgcgacagatgcctccggcgtggtaacg
cgtgaataccgctataacgaccgcggcctgatggtctggcaccgcctgccaggtgggctg
gaaagtgaataccgctggcaaaaattcgaccactggcgcgtggtggaaaaccgcaccagc
accggcgacgggtgccgctttagctatgatttagccgccgggctgacgaccgtcgagcac
tacgacggccagacgcgtaagcactactggaacgcgcaaaatctgattgtccgttacgtt
gacgagcgcggtgaaaactggcgctacgagtgggatgacaacgaacttctgacccgtcgc
gtcgatcccctcggcaatgccgttacctttgtctacgacgaaatgggcaaccgggtgcag
gagatcgacgccgacggcaatacccgtaccaccacctggctggagcaccgcgcgcttccg
gcggcaattatcgaagccgacggcagcgcgacccgtttctggtacgacgaacatcacggc
ctgaagcgcgtggtcgacccgatggggcagaccacgctcctgcaccgggatgagtttggt
caggtggttgaggaggtcgatgccgccggaaacagccgctatcaggagtataacgacgcc
gggcagatggtacgtgcgacggactgttccgggcgcattacccgctaccgttatcatccg
ctcggctggctggtggccgagactggcgccgacggcgaagagacgcgctatcgctacgac
gcggcaggacgtccggtacagctcgatcgtccggaaggctggacggagtcacttgcatgg
aacgagcgcggcctgccggtgaagcatgcgggcgctgacggaaaagaaagcgagttcaga
tacgatgacgcagggcgcttaaccgccacccgcaatactcagggggaagaggtgcgccgc
cgctgggacagccgcgggcgtctggttgccctggaaaacgaaaacggcgaagcgtaccgg
ttccgctggggcgcggactcgctgcttctggaagagacagggcttgatggcgtggcctcg
cagtatcgctacgacgcctgcgggcgtacgatagcgcgcacgtttgccgccggtcacccg
gaggcaatcacccacgccttcgcctggagcgcaagcggccagctggtcgcccgcaccacg
ccggaagggcagactcgctatcattacacaccgtccgggctattaagccggatcgggctg
catcctgagctttcagccgacgcgtggaccaccgaggccgagcaggagcttgcctttgac
tatgacgcgctcggtcgcgtgacgcgcgaggcgggcgaacacggcgagctggcgtgggag
tatgacgcgctgggcaaccgcacctccctcacgctgcccgatggccgcgagctgaaacag
ttctactacggcagcgggcatctgctcggcattgccctcgataagctgtcggtctctgat
ttcacccgcgacgaactccaccgggagaccagccgcactcaggggctgctgaccacccgc
agcgagtacgaccgtctcggtcgactgcatcgccgggatgtcttcactggcaatgcccaa
cgcccgtcgccgcgccgctggtctcgccgctgggattacgattaccgcaataacctggtg
cgggaagagcgggacgataatccgttcagctggtaccgctggcagtatgacagcgccggg
cgcctgctggttcaggacggctcgctgcccggacaggagcagtggcgctgggatgccgcc
ggtaacccgctggaagactctgctgagaaggtcacgcataaccgcctgacgcagctgaac
ggcattcgctggcgttatgacattcacggccgcaccgtggagaaggataacggccagacc
cggtggcactaccgctacgacggcgagcaccgcctgacggaggtcatcagccagccgcgg
gatcgcaacaaaccgcagacgcaggtcaacttccgctacgatccgctcggacgacggatc
agcaaaacgcgtcgccagatgctgggcgggcagccaaccggcaagccggtcactacccgt
tttgtctgggaggggttccgcctgctgcaggaattgcacggggatgtgccgctgacctac
gtctacagcgatcaggacagctacgatccgctggcgcgtatcgacggcgtggttgccccg
gaaatcttctggttccactgtcagcccaacggcacgccggagcggatgacggatatcgaa
gggcaggtgcgctgggacgcggtgaacagcgcctggggcaagctgctgcgggaaagcgaa
acgcaggtatcaggatattctcagaacctgcgcatgcagggtcaatacctggatcgtgag
acagggctgcactacaatctgttccggtattacgacccggactgcggaaggtttacgcag
caggacccgatagggctggcgggggggataaacctttaccagtatgcgccgaatgcgctg
gggtgggtggatccgtgggggttgagccgtgagtgtagcggtaaaacaaaacctgatttc
tatgtcggtccagcgggaccaagcgctacaatgccttcaactgcttatcgttatgttcga
tacttgaatgacgatggcagtttagataaatgggctcctggtcttctcgaaacaaaaaaa
gcgcccgtaacgtattttggattcgaaaaatttgaaacgggtaaagcggctcgtgatgcg
tttcagataaaaggtcccgataaagttgatccgacgttaccagcggatgtctcttggagt
gatgcaaggattagaggaacgtttgatacattgcaactttacgaaaatggtactccacaa
gtgaggcatccaagaatgtttggagatgaaattggtgcaccattagaacaatttacgcat
gcctatccgcaatacggaaaggggggcgtagaacaaatgcatgcagaaaaacggacaatt
attttcgataaaattgatattcttccggaggaataa

DBGET integrated database retrieval system