KEGG   Enterobacter cloacae subsp. cloacae ENHKU01: ECENHK_13195Help
Entry
ECENHK_13195      CDS       T02315                                 

Definition
(GenBank) hypothetical protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
eno  Enterobacter cloacae subsp. cloacae ENHKU01
Pathway
eno03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:eno00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ECENHK_13195
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eno02044]
    ECENHK_13195
Secretion system [BR:eno02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ECENHK_13195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_HCP
Motif
Other DBs
NCBI-ProteinID: AFP70490
UniProt: A0A0F0XPU6
Position
complement(2796139..2796621)
Genome map
AA seq 160 aa AA seqDB search
MAIDMFLKVEGVTGESKDSNHTGWTDITSFSWGASQPGNMSVGGGGGAGKVNFNDLHVNA
LIDKSTTAILKHCASGKHLTKVELSVCKAGGQQVEYTRITLEDVLVTSVQYTGADNGDTV
GVTYAFQAAKVKQQYWEQTTAGGKGAESSAGWNIKENKEA
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atggctattgatatgtttctgaaggtcgagggtgttacgggcgaatctaaagattctaac
cacaccggctggactgatattacctccttctcctggggcgcttcccagccaggtaatatg
agcgttggcggtggcggcggtgccggtaaagtaaactttaacgatctgcacgttaatgct
ctgatcgacaaatccaccactgcaatcctgaaacactgcgccagcggtaaacacctgacc
aaagttgaactgtccgtctgtaaagccggtggtcagcaggtggaatatacccgcatcacg
ctggaagatgtgctcgtgacttctgttcagtacaccggtgcagacaacggcgataccgtt
ggtgtgacctacgcgttccaggctgcgaaagtgaaacagcagtactgggagcagaccact
gccggtggtaaaggtgctgaaagcagcgctggctggaacatcaaagaaaacaaagaagcg
taa

DBGET integrated database retrieval system