KEGG   Enterobacter kobei ENHKU01: ECENHK_13240
Entry
ECENHK_13240      CDS       T02315                                 

Definition
(GenBank) hypothetical protein
  KO
K11893  type VI secretion system protein ImpJ
Organism
eno  Enterobacter kobei ENHKU01
Brite
KEGG Orthology (KO) [BR:eno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eno02044]
    ECENHK_13240
Secretion system [BR:eno02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ECENHK_13240
SSDB
Motif
Pfam: T6SS_VasE IcmF_C
Other DBs
NCBI-ProteinID: AFP70499
Position
complement(2806538..2807881)
AA seq 447 aa
MTKAEKVVWTEGMFLRPHHFQRTESYLLNHVREWGALQRSYLWGFLDVELDEAMLRQGCI
ALSYCSGLLPDGTFFQVRNGRNGPVPLKIPDNLTNEKVVLALPVRRGEREEVIFSEEPAS
LARFIAFEQEVEDDNAMSVGDATVQFGRLRLTLMLEKDLTAEWTAIGVAFVTEKRHDNHV
RLDNSYIPPMLNANNSPQIYSMINDLHGLLVQRSQQIGGRLRQPGRFNTSELIEFTLLSL
VNRHLGEVSHLKTLPLLHPETLWRSWLPFASELATWTPQRTTESVLPVYDHDDLANCFSK
LMLMLRQGLSLVMEDHAIQLPLNERSHGLNIATVPETSMVREFGFVLAVKANVPGEHLQT
HFPAQMKIAPVSKIRDLVQLQLPGIMLRAMPVAPPQIPWHAGYSYFELEKGSELWHEMDK
SGAFALHLAGEFPGLDMEFWAIRSPTE
NT seq 1344 nt   +upstreamnt  +downstreamnt
atgacgaaagcagaaaaggtcgtctggaccgaaggcatgttcctgcgtccacaccatttt
cagcggactgaaagttatctgctcaaccacgttcgtgaatggggtgcgttgcagcgttcc
tatctttggggctttcttgatgttgaactcgacgaagcgatgcttcgtcagggatgcatt
gccctgagctactgcagtgggcttctgccagacgggactttcttccaggtacgcaacgga
cgcaatggtcctgtgccgcttaaaatccctgacaatctcaccaacgaaaaggtggtgctc
gcactgccggtacgtcgtggcgagcgggaagaggtgatcttcagcgaagagccggcctcg
ctggcgcgcttcatcgcgttcgagcaagaggtcgaagacgacaacgccatgtcggtgggg
gatgccaccgtacagtttggccgcctgcgcctgacgctgatgctggaaaaagatctcacg
gcagaatggaccgccatcggcgtggcgtttgtcactgaaaaacgccacgacaaccacgtc
cggctcgataacagctacatcccgccgatgctgaacgccaataacagtccgcagatctac
agcatgattaacgatctgcacggcttactggtgcagcgcagccagcagatcggcggccgt
ctgcgccagcctggccgttttaacacctcggaactgattgaatttacgttactgtcgctg
gtgaaccgtcatcttggcgaggtttcgcatttaaaaacgctgccgctgctgcacccggaa
accctctggcgcagctggctgccgtttgcgtccgagcttgccacctggaccccacaacgg
accacggagagcgtgctgccggtctacgatcacgacgatctggcgaactgcttcagtaag
ctgatgctgatgctgcgtcaggggttgtcgctggtgatggaagaccacgctattcagctg
ccgcttaacgagcgctcgcatggtcttaacattgccaccgttcctgaaaccagcatggta
cgcgagtttggcttcgtgctggccgtcaaagcgaatgtgcccggcgaacacctgcaaacc
catttccctgcgcagatgaaaatcgcgccggtgtcgaaaatccgcgatctggtccagctt
cagctgccgggcattatgctgcgcgccatgccggtcgcgccgccgcagatcccgtggcat
gcaggctacagctatttcgagctggagaagggcagcgagctgtggcacgagatggataag
tccggcgccttcgccctgcacctggcaggggagttcccggggctggatatggagttttgg
gccatccgtagcccgacagaataa

DBGET integrated database retrieval system