KEGG   Enterobacter cloacae subsp. cloacae ENHKU01: ECENHK_15520Help
Entry
ECENHK_15520      CDS       T02315                                 

Definition
(GenBank) acetate kinase A/propionate kinase 2
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
eno  Enterobacter cloacae subsp. cloacae ENHKU01
Pathway
eno00430  Taurine and hypotaurine metabolism
eno00620  Pyruvate metabolism
eno00640  Propanoate metabolism
eno00680  Methane metabolism
eno01100  Metabolic pathways
eno01120  Microbial metabolism in diverse environments
eno01200  Carbon metabolism
Module
eno_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:eno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ECENHK_15520
   00640 Propanoate metabolism
    ECENHK_15520
  09102 Energy metabolism
   00680 Methane metabolism
    ECENHK_15520
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    ECENHK_15520
Enzymes [BR:eno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     ECENHK_15520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: AFP70945
UniProt: A0A0P8IL57
Position
3314623..3315825
Genome map
AA seq 400 aa AA seqDB search
MSSKLVLVLNCGSSSLKFAIIDALNGDEYLSGLAECFHLPEARIKWKMDGSKQEAALGAG
AAHSEALNFIVNTILAQKPELSAQLTAIGHRIVHGGEKYTSSVVIDESVIQGIKDSASFA
PLHNPAHLIGIAEALKSFPNLKDKNVAVFDTAFHQTMPEESYLYALPYSLYKEHGVRRYG
AHGTSHFFVTQEAAKILNKPVEEVNIITCHLGNGGSVSAIRNGKCVDTSMGLTPLEGLVM
GTRSGDIDPAIIFHLHDTLGMSVDDINKMLTKESGLLGLTEVTSDCRYVEDNYAEKADAK
RAMDVYCHRLAKYIGSYTALMDGRLDAVIFTGGIGENAAMVRELSLGKLGVLGFDVDHER
NLAARFGKSGFINKEGTRPAIVIPTNEELVIAQDAHRLTA
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagtaagttagtactggttctgaactgcggtagctcctcactgaaattcgccatc
atcgatgcgctcaacggtgacgagtacctctctggtttggccgaatgtttccatctgcct
gaagcacgtatcaagtggaagatggacggcagcaaacaagaagcggctttaggtgcaggc
gccgctcacagtgaagcgctgaactttatcgttaacactattctggcacaaaaaccagaa
ctgtctgctcagctgactgcgattggtcaccgtatcgtccacggcggcgaaaaatacacc
agttccgtcgtgatcgacgaatctgttatccagggcatcaaagattctgcctcttttgct
ccgctgcacaacccggcgcacctgatcggtatcgctgaagcgctgaaatccttccctaat
ctgaaagacaaaaacgtggccgtgttcgacaccgcgttccatcagaccatgccggaagag
tcttacctctatgccctgccatacagcctgtacaaagagcacggcgtacgtcgttacggc
gcgcacggcaccagccacttctttgtgactcaggaagccgcaaaaatcctgaacaaacct
gttgaagaagtgaacatcatcacctgccatctgggcaacggtggttctgtttctgctatc
cgcaacggtaaatgtgttgatacctccatgggtctgaccccgctggaaggtctggtgatg
ggtacccgttccggtgacatcgacccggcgatcatcttccacctgcacgacactctgggc
atgagcgttgacgacatcaacaaaatgctgactaaagagtctggcctgctgggtctgacc
gaagtcaccagcgactgccgctatgttgaagacaactacgcagagaaagcagacgctaaa
cgtgcaatggacgtttactgccaccgtctggcgaaatacatcggttcttacactgcgctg
atggacggtcgtctggacgcggttatcttcaccggtggtatcggtgagaacgcggctatg
gttcgtgaactgtccctgggcaaactgggcgttctgggcttcgacgttgatcacgagcgt
aacctggctgcgcgtttcggcaagtctggcttcatcaacaaagaaggcacccgtccggct
atcgttatcccaactaacgaagagctggtcatcgcgcaagacgcacaccgcctgactgcc
tga

DBGET integrated database retrieval system