KEGG   Enterobacter cloacae subsp. cloacae ENHKU01: ECENHK_15745Help
Entry
ECENHK_15745      CDS       T02315                                 

Gene name
fadJ
Definition
(GenBank) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
eno  Enterobacter cloacae subsp. cloacae ENHKU01
Pathway
eno00071  Fatty acid degradation
eno00280  Valine, leucine and isoleucine degradation
eno00281  Geraniol degradation
eno00310  Lysine degradation
eno00362  Benzoate degradation
eno00380  Tryptophan metabolism
eno00410  beta-Alanine metabolism
eno00640  Propanoate metabolism
eno00650  Butanoate metabolism
eno00903  Limonene and pinene degradation
eno00930  Caprolactam degradation
eno01040  Biosynthesis of unsaturated fatty acids
eno01100  Metabolic pathways
eno01110  Biosynthesis of secondary metabolites
eno01120  Microbial metabolism in diverse environments
eno01130  Biosynthesis of antibiotics
eno01200  Carbon metabolism
eno01212  Fatty acid metabolism
Module
eno_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:eno00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ECENHK_15745 (fadJ)
   00650 Butanoate metabolism
    ECENHK_15745 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    ECENHK_15745 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    ECENHK_15745 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ECENHK_15745 (fadJ)
   00310 Lysine degradation
    ECENHK_15745 (fadJ)
   00380 Tryptophan metabolism
    ECENHK_15745 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ECENHK_15745 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ECENHK_15745 (fadJ)
   00281 Geraniol degradation
    ECENHK_15745 (fadJ)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ECENHK_15745 (fadJ)
   00930 Caprolactam degradation
    ECENHK_15745 (fadJ)
Enzymes [BR:eno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     ECENHK_15745 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ECENHK_15745 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     ECENHK_15745 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 DUF362
Motif
Other DBs
NCBI-ProteinID: AFP70990
Position
complement(3357950..3360097)
Genome map
AA seq 715 aa AA seqDB search
MEMTSAFNLTVRLDNVAVIAIDVPDEKMNTLKAEFGIQVRAMLRQIRENKAIRGLVFISA
KPDNFIAGADINMIARAQSAQEAEDLARQGQQVMAEINALPIPVIAAIHGACLGGGLELA
LACHSRICTDDAKTVLGLPEVQLGLLPGSGGTQRLPRLVGVSTALEMILTGKQLRARQAL
KAGLVDDVVPHAILLEAAVELALKGRQPKRPLPVRERVLAGPLGRTILFNMVGKKTEQKT
KGNYPAAKRILEVIETGLSQGSSSGYAAEAKAFGELAMTPQSRALRSIFFASTEVKKDPG
SEAEPAPLRAIGVLGGGLMGGGISFVTASKGKLPVRIKDINPKGINHALQYSWQNLDQKV
KRRHIKASERDKTLAMISGTTDYSGFAHRDLVIEAVFEDLALKQQMVADVEQHCASHTIF
ASNTSSLPIGDIAAKAARPEQVIGLHFFSPVEKMPLVEVIPHATTSPQTIATVVKLAKKQ
GKTPIVVADKAGFYVNRILAPYINEAMRLLTEGEKIEHVDEALVKFGFPVGPIQLLDEVG
IDTGTKIIPVLEAAYGDRFAPPANIVSAILKDDRKGRKNERGFYLYGAKGRKSKKQVDPS
VYGLIPTSGQGRLSAVQCAERCVMMMLNEAARCFGEQVIKSARNGDIGAVFGIGFPPFLG
GPFRYMDTLGAGEVVAILQRLATQYGPRFTPCDELLQMAERGQTFWPARETVLVS
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atggaaatgacatctgcatttaacctgacggttcgcctcgataacgtcgccgtgatcgcc
attgatgtgcctgacgaaaaaatgaataccctgaaggcggagtttggcattcaggttcgc
gcgatgctcaggcagatccgcgaaaacaaggccattcgcggtctggtgtttatctcggcc
aagccggacaactttattgccggggccgacattaacatgatcgcccgggcgcaaagtgcg
caggaagcggaagatcttgcgcgtcaggggcagcaggtgatggccgagatcaacgcgctg
ccgatcccggtgattgccgcgatccacggtgcttgtttgggtggtggactggagctggcg
ctggcctgccacagccgcatttgtactgacgatgcgaaaaccgttctgggcctgccggaa
gtgcaattaggtctcctgcctggttcaggtggcacgcagcgtctgccgcgcctggtaggg
gttagcaccgcgctggaaatgattctcaccggcaagcagctgcgcgcccgtcaggcgctg
aaagccggtctggttgacgatgtcgttccccacgcgattttactggaagctgctgtagaa
ctggcgctgaaaggtcgccagccaaaacgtcctcttccggtgcgagagcgtgtgctggcg
ggtcctctgggaaggacgatcctgttcaacatggtgggcaaaaagaccgaacaaaaaacc
aaaggcaactacccggcggcgaaacggatcctggaggtgattgaaaccgggttgtcacag
ggaagcagtagcggctatgccgctgaagccaaagcctttggcgagctggcgatgacgccg
cagtcacgggcgctgcgcagcatcttcttcgccagcacagaggtgaaaaaagatccgggc
agtgaggctgagcctgctccgctgcgtgcaattggcgtgctcgggggtgggctgatgggc
ggcggcatttctttcgttaccgcaagtaaagggaaactgccggtacgcatcaaagacatt
aaccctaagggaatcaaccacgcgctgcagtacagctggcagaaccttgatcaaaaggtc
aagcgccgccatatcaaggcaagcgagcgtgataaaaccctggcgatgatctccggcacg
acggactacagcggttttgcgcaccgcgatctggtgattgaagccgtatttgaagatctg
gcgctcaagcagcagatggtggcggacgttgaacagcattgtgcgtcgcataccattttt
gcctcgaatacgtcgtcattacccatcggcgatatcgcagcgaaagccgcacgtcctgag
caggtgataggtctgcactttttcagcccggtagaaaaaatgccgctggtggaggtgatc
cctcacgccacaaccagcccgcaaaccatcgctaccgtggtgaagctggcgaaaaaacag
ggcaaaacccccatcgtggttgcggacaaagccggcttctacgtcaaccgtattctggcg
ccgtacatcaacgaagcgatgcggctgctgacggaaggggagaagattgagcacgtcgat
gaggcactggtaaagtttggcttccccgttggtcctatccaacttttggatgaggtggga
atagacaccggcactaaaattatacctgtactggaagccgcttatggcgatcgttttgcg
ccgcctgcaaatattgtttctgcaattttgaaggacgatcgcaaaggcagaaaaaatgaa
cgcggtttctatctttacggcgcgaaagggcgtaaaagcaagaaacaggtcgacccttct
gtttatgggcttatcccgacctcaggtcaggggagactctccgccgttcagtgtgctgaa
cgttgtgtgatgatgatgctcaatgaagcggcacgctgctttggtgagcaggtgatcaag
agcgcacggaatggcgacatcggcgccgtatttggtattggtttcccgccgttccttggc
ggcccgttccgttacatggatacactcggcgcgggtgaagtggtggctattttgcaacgt
ctggcaacgcaatatggcccgcggtttacaccgtgtgacgaattattgcagatggcggaa
cggggccagacattttggcctgcaagggaaactgtcctcgtaagctga

DBGET integrated database retrieval system