KEGG   Enterobacter cloacae subsp. cloacae ENHKU01: ECENHK_15805Help
Entry
ECENHK_15805      CDS       T02315                                 

Definition
(GenBank) type VI secretion system protein VasJ
  KO
K11910  type VI secretion system protein VasJ
Organism
eno  Enterobacter cloacae subsp. cloacae ENHKU01
Brite
KEGG Orthology (KO) [BR:eno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eno02044]
    ECENHK_15805
Secretion system [BR:eno02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ECENHK_15805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VasJ ImpA_N
Motif
Other DBs
NCBI-ProteinID: AFP71002
UniProt: A0A2J0PRX2
Position
complement(3371543..3373141)
Genome map
AA seq 532 aa AA seqDB search
MDTLQNLIAACQADETQLRKQAQARTESWHPWLAPVNETRATGEEPGYDDDFQRIREEVN
KLSGIDTGLICTLAEKLLTTTAKDIRIATYYCWARLHQDGETGFAEGLELVAGLLQRYGT
QLHPQRERSRKPALEWLAGSRLLDSLSLWPEVVRDDALRTAGALLLIHDALQTEPETSRP
ELNALYSALESRLMKAGGVDAVVPQNAGNQSQLPASYSTESDAPVMSRITSGQDLLAQAR
TLTGYLREQPDGWLAAHRLMKSLRHDTLSAIPAPDAEGKTRIEPPRADQRAMLKRLYLQQ
SWLEILEQADSTFSRGANHLWLDLQWYIHQALVKLGQDVLADIITADLKGLLRRLTGLET
LAFNDGTPFADEVTLNWINQSVLDDMSGWRDEPVSAGSGEDNDILTLEPEALEKADTDGL
DAALHWLQTRPGTDAIKDKWLLRLLMARIAEQKGKNELALHLLGELDSTAQSITLTQWTP
ALLFEVKSRRLRLLRMKASRSETDRSRLQPEMDLLLSGLIALDPASSAVLCG
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggacactctgcagaatctgattgccgcctgtcaggcggacgaaacccagctgcgaaag
caggctcaggcacgcacggaaagttggcacccctggcttgccccggtaaatgagacccgt
gcaacaggagaagagcccgggtatgacgatgattttcagcgcataagagaggaggtgaat
aaactctccggtatcgatacgggactgatttgtacgcttgccgaaaaactgctgacgact
accgccaaagatatccgcattgcgacctattactgctgggcgcgattgcaccaggacggt
gaaacaggctttgccgaagggcttgagttagtggcgggattgctgcagcgctacggaacg
caacttcatccgcagcgggagcgaagccgtaagcccgcgctggagtggcttgcaggttct
cgtctgcttgacagcctgtcactctggccagaagtggtccgcgacgatgcccttcgcacg
gcaggcgcgctgttgctcatccatgacgctctgcaaacagagccggaaacgtcacgaccc
gagctgaatgccctgtacagcgcgctggaatcccgcctgatgaaggcggggggcgtggat
gccgtggtacctcagaatgccggtaatcagtcccaactcccggcttcgtactcgacggag
tctgacgcacccgttatgagccgcatcacgtccggtcaggatctgctggcgcaggcacgc
acgttgaccgggtatctgcgtgaacaacccgatggctggcttgccgctcaccggctgatg
aagagcctgaggcatgacaccctgagcgctattcctgcaccggatgccgaagggaaaaca
cgcattgaaccaccccgggcagaccagcgggcgatgctgaaacgcctgtacctgcagcag
agctggctggagatactggagcaggcggacagcaccttctcgcgtggcgctaatcacctc
tggctggatctgcagtggtatatccatcaggcgctggtgaagttggggcaggatgtgctg
gccgacatcatcaccgccgacctgaaagggctgctgcgccgccttaccggactggaaacc
ctggcttttaatgacgggacgccatttgccgatgaggtcacgctgaactggattaatcag
agcgtactggacgatatgtccggctggcgggatgagccggtcagtgccggcagtggagag
gataacgatatcctgaccctcgagccggaagcgctggagaaagcggacacggacggtctg
gacgcggcactccattggctgcagacccgcccgggcaccgacgccataaaagacaaatgg
ctgctgcgcctgctgatggcgcgtatagccgagcagaagggcaaaaatgaacttgccctc
catctgctgggcgagctggacagtacagcacagtccatcaccctcacgcagtggacaccg
gcgctgttgtttgaagtcaaatcccgccgactcagactgctgcgcatgaaagcctcgcgc
agcgaaaccgacagatcacggcttcagcctgagatggatttgcttctgtccggtctgatt
gcgctcgatccggcaagcagtgcggtgctttgcgggtaa

DBGET integrated database retrieval system