KEGG   Enterobacter cloacae subsp. cloacae ENHKU01: ECENHK_18080Help
Entry
ECENHK_18080      CDS       T02315                                 

Definition
(GenBank) acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
eno  Enterobacter cloacae subsp. cloacae ENHKU01
Pathway
eno00071  Fatty acid degradation
eno00072  Synthesis and degradation of ketone bodies
eno00280  Valine, leucine and isoleucine degradation
eno00310  Lysine degradation
eno00362  Benzoate degradation
eno00380  Tryptophan metabolism
eno00620  Pyruvate metabolism
eno00630  Glyoxylate and dicarboxylate metabolism
eno00640  Propanoate metabolism
eno00650  Butanoate metabolism
eno00900  Terpenoid backbone biosynthesis
eno01100  Metabolic pathways
eno01110  Biosynthesis of secondary metabolites
eno01120  Microbial metabolism in diverse environments
eno01130  Biosynthesis of antibiotics
eno01200  Carbon metabolism
eno01212  Fatty acid metabolism
eno02020  Two-component system
Brite
KEGG Orthology (KO) [BR:eno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ECENHK_18080
   00630 Glyoxylate and dicarboxylate metabolism
    ECENHK_18080
   00640 Propanoate metabolism
    ECENHK_18080
   00650 Butanoate metabolism
    ECENHK_18080
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ECENHK_18080
   00072 Synthesis and degradation of ketone bodies
    ECENHK_18080
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ECENHK_18080
   00310 Lysine degradation
    ECENHK_18080
   00380 Tryptophan metabolism
    ECENHK_18080
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ECENHK_18080
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ECENHK_18080
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ECENHK_18080
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:eno04147]
    ECENHK_18080
Enzymes [BR:eno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ECENHK_18080
Exosome [BR:eno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ECENHK_18080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AFP71447
Position
complement(3866946..3868124)
Genome map
AA seq 392 aa AA seqDB search
MKDVVIVGALRTAIGCFQGALARHSAVDLGSVVVKALVERSGVAAHEIDEVILGQVLTAG
AGQNPARQAALKGGLPNTVSAITINDVCGSGLKALHLATQAIQCGEADVVIAGGQENMSR
APHVLTDSRTGAQLGNSQLLDSLVHDGLWDAFNDYHMGVTAENLAREYGISRELQDAYAL
SSQQKARAAIDSGRFRDEIVPVSTQRQNGEVVVVDTDEQPRTDASAEGLARLNPAFETQG
SVTAGNASSINDGAAAVMMMSESKALELDLPVLARIKAFASVGVDPALMGIAPVYATRRC
LDRAGWQLSDVDLIEVNEAFAAQAISVGKMLEWDPLRVNVNGGAIALGHPIGASGCRILV
SLVHEMKKRNARKGIATLCIGGGQGVALAIER
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgtcgtcatagtgggtgcgttgcgtacagctatcggctgttttcagggagcg
ctcgcgcgtcactcggcggttgacctgggcagcgtggtggtcaaagcgctggtggaacgt
agcggggtcgccgcacacgaaattgatgaggtgatcctggggcaggttctcactgccgga
gccgggcaaaaccctgcgcgccaggcggccctgaaaggcggtctgcccaacaccgtatcc
gccatcaccatcaacgacgtctgtggttcaggactcaaagcgcttcatctcgctacgcaa
gccattcaatgcggtgaagcggatgtggttattgctggcggacaagagaatatgagccgt
gcgccgcacgttctcaccgacagtcgtaccggtgcgcagttaggtaacagtcagttgctc
gacagcctggtgcatgacgggctgtgggatgcgttcaatgactatcatatgggcgtgacg
gcggaaaacctggcgcgcgagtacggtatcagccgtgaattgcaggatgcttacgcgctc
agttcccagcaaaaggcgcgtgctgcgattgattctggtcgttttcgcgacgagattgtc
ccggtcagcacgcagcgtcagaacggcgaggtggttgtcgtggatactgacgaacagccg
cgcactgacgccagtgctgaaggcctggcaagactcaatcctgcgtttgaaacccagggc
tcggtcacggcgggcaatgcctcttccattaacgacggcgccgcagccgttatgatgatg
agtgaaagtaaagccctggagctggatctccctgtcctggcccgcatcaaggcttttgcc
agcgtgggtgttgatcctgcactgatggggatcgcacccgtctacgctacccgtcgctgt
ctggatcgcgcagggtggcaactctccgatgtggatctgattgaagtgaacgaagcgttt
gccgcgcaggcgatctcggtcggcaaaatgctggagtgggatccgctgcgggtcaacgta
aacggtggagccattgcgctgggtcaccctatcggggcgtccggttgccggatactggtt
tcactggtccacgaaatgaaaaaacgcaatgcccgcaaagggatagcaacgctctgtata
ggcggcgggcaaggggtggcgctggccatcgaacgctaa

DBGET integrated database retrieval system