KEGG   Enterobacter kobei ENHKU01: ECENHK_19370
Entry
ECENHK_19370      CDS       T02315                                 

Definition
(GenBank) Hcp family type VI secretion system effector
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
eno  Enterobacter kobei ENHKU01
Pathway
eno03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:eno00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ECENHK_19370
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eno02044]
    ECENHK_19370
Secretion system [BR:eno02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ECENHK_19370
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: AFP71705
Position
4134597..4135082
AA seq 161 aa
MAVPVHIWFYDDGGSLIKGSCDVQDREGSVEIRGLTHNLSIPTDPLSGRLTGTRKHAPFL
FEKEIDSSSPYLYKAVATGQNLKKVEIRYYRINNAGWEVEYFRTELEGVKVVSISPIVND
TRNCPGTGHLESVQLRYEKATWTYCDGNIQFSDAWNERASA
NT seq 486 nt   +upstreamnt  +downstreamnt
atggccgtacctgttcacatttggttctatgacgacggtggctcactcattaaaggttca
tgtgatgttcaggatcgtgaagggagtgttgaaattagaggtttaacccataacttgagt
attccaaccgatccactctccggaagattaaccggaacgaggaaacacgcgcctttttta
ttcgagaaggaaattgatagctcatctccctatctttataaggcggtagcgacagggcaa
aaccttaagaaagttgagattagatattaccgaatcaataacgcaggttgggaggttgaa
tactttagaactgagctggaaggtgtgaaagttgtctctatttcgcctattgttaacgat
actcgtaactgtccaggtactggccaccttgaatctgttcaattgcgctatgaaaaagcg
acctggacctattgcgacgggaatattcaattctctgatgcatggaacgaacgggcatca
gcatga

DBGET integrated database retrieval system