KEGG   Enterobacter cloacae subsp. cloacae ENHKU01: ECENHK_20710Help
Entry
ECENHK_20710      CDS       T02315                                 

Gene name
ompR
Definition
(GenBank) osmolarity response regulator
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
eno  Enterobacter cloacae subsp. cloacae ENHKU01
Pathway
eno02020  Two-component system
Brite
KEGG Orthology (KO) [BR:eno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ECENHK_20710 (ompR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:eno02022]
    ECENHK_20710 (ompR)
Two-component system [BR:eno02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   ECENHK_20710 (ompR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C FleQ
Motif
Other DBs
NCBI-ProteinID: AFP71973
UniProt: A0A0F0YAF0
Position
complement(4399699..4400418)
Genome map
AA seq 239 aa AA seqDB search
MQENYKILVVDDDMRLRALLERYLTEQGFQVRSVANAEQMDRLLTRESFHLMVLDLMLPG
EDGLSICRRLRSQSNPMPIIMVTAKGEEVDRIVGLEIGADDYIPKPFNPRELLARIRAVL
RRQANELPGAPSQEEAVIAFGKFKLNLGTREMFREDEPMPLTSGEFAVLKALVSHPREPL
SRDKLMNLARGREYSAMERSIDVQISRLRRMVEEDPAHPRYIQTVWGLGYVFVPDGSKA
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgcaagagaactacaaaattctggtcgtggatgacgacatgcgcctgcgtgcgctgctg
gagcgttatctgaccgagcagggcttccaggttcgtagcgtcgcgaacgctgagcagatg
gatcgtctgctaacccgtgaatctttccatctgatggttctcgacctgatgctgccgggc
gaggacgggctctctatctgtcgtcgtctgcgtagccagagtaacccgatgccgatcatc
atggtgaccgcgaagggtgaagaagttgaccgtatcgtgggcctcgaaatcggcgcggat
gactacattccaaaaccgtttaacccgcgtgaactgctggcgcgtattcgtgccgtgctg
cgtcgtcaggcgaacgagctgcctggcgcaccgtcgcaggaagaagcggtgattgccttc
ggcaagttcaagctgaacctcggtacgcgtgagatgttccgtgaagacgagccaatgccg
ctcaccagcggtgagtttgcggtgctgaaagcgctggtcagccacccgcgtgagccgctt
tcccgtgacaagctgatgaacctggcgcgtggtcgcgaatactcggcaatggaacgctcc
atcgacgtgcagatctcccgtctgcgccgcatggtggaagaagatccggcgcatcctcgt
tatattcagaccgtatggggtctgggctacgtgtttgtcccggacggctctaaagcatga

DBGET integrated database retrieval system