KEGG   Enterobacter sp. R4-368: H650_00760Help
Entry
H650_00760        CDS       T02700                                 

Definition
(GenBank) hypothetical protein
  KO
K11893  type VI secretion system protein ImpJ
Organism
enr  Enterobacter sp. R4-368
Brite
KEGG Orthology (KO) [BR:enr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:enr02044]
    H650_00760
Secretion system [BR:enr02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   H650_00760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VasE
Motif
Other DBs
NCBI-ProteinID: AGN83755
UniProt: R9VK06
Position
18753..20096
Genome map
AA seq 447 aa AA seqDB search
MNKAEKVVWTEGMFLRPHHFQRAESYLQHHIREWGTLQRPYLWGYLDIELDDAMLRQGCI
ALSYASGLLPDGTFFSFHDARQAPTPLAIPDNINNERVVLALPARRGGRDEVIFSEEKDS
LARYVTWESEVDDDNAMSVGPAAVQFGRLRLKLMLEKDLSAEWTAIGVAHVVEKRNDNHV
RIDSRYIPPMLNAVNNPAIYAIINDLQSLLMQRSQQIGQRLRQPGRFNTSEMVEFTLLAL
INHHVGQVSHLKTLPMIHPEELWRSWLAFATELTTWTASRSPEETLPVYDHDDLAGCFGK
LQLMLRNGLSLVMEEHAIQLPLTERTHGLNIATLPTTTMAREFGFVLAVKASVPGEILQT
HFPAQMKVAPVTKIRDLVQLQLPGMKLRTMPVAPPQIPWHAGYNYFELEKGGELWNEMEK
SGAFALHLAGEFPGLDMEFWAIRSPTE
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaagcagaaaaggtcgtgtggaccgaaggtatgtttctgcgccctcatcacttt
cagcgagcggaaagctatctgcaacaccatattcgcgagtgggggacactgcagcgcccg
tatctttggggctaccttgatatcgagctcgacgatgccatgctgcgccagggctgtatt
gccctgagttatgccagcggtttactgccggatggcacgttcttctcattccacgatgct
cgccaggcgcccacaccgctggctatccctgacaacatcaacaatgagcgcgtggtgctg
gcgctgcctgcccgtcgcggcgggcgtgatgaggtgatctttagcgaagagaaagattcg
ctggcgcgttatgtcacctgggaaagcgaagtcgatgacgataacgccatgtccgtcggg
ccggcggcggtgcagtttggccgtctgcgtctgaaactgatgctggaaaaagatctctcg
gcagagtggacggcgatcggtgtcgcgcatgttgtagaaaaacgtaacgataaccacgtt
cgaattgatagccgttatattccgccgatgctgaatgcggttaacaacccggcgatttac
gccattatcaacgatctgcaaagtttgctgatgcagcgtagccagcagattggccagcgt
ctgcgccagccggggcgttttaatacctctgaaatggtggaattcacgctgctggccttg
attaaccaccatgtcggccaggtttcccatctgaaaacgctgccgatgatccacccggaa
gagttgtggcgcagctggctggcgtttgccaccgagctgaccacctggaccgcgtcacgc
tcgccggaagagacgctgccggtttacgaccatgacgatctggccggctgttttggcaag
ttacaactgatgctgcgcaatgggttgtctctggtgatggaagagcacgccatccagttg
ccgctcaccgaacgcacgcacgggttgaatatcgccacgttgccgaccaccaccatggcg
cgcgagtttggtttcgtgctggcagtgaaagccagtgtcccgggcgaaatcctgcaaacc
catttcccggcccagatgaaagtcgcgccggtcaccaaaatccgcgacctggtgcagttg
caactgccgggtatgaagttgcgcaccatgccggtcgcgccgccgcaaattccgtggcat
gccggttacaactatttcgaactggaaaagggcggcgagctgtggaacgaaatggaaaaa
tcgggggctttcgcgctgcatctggcaggtgaattcccgggtcttgatatggagttttgg
gccatccgtagcccgactgaataa

DBGET integrated database retrieval system