KEGG   Enterobacter sp. R4-368: H650_00845
Entry
H650_00845        CDS       T02700                                 

Definition
(GenBank) type VI secretion system protein ImpG
  KO
K11896  type VI secretion system protein ImpG
Organism
enr  Enterobacter sp. R4-368
Brite
KEGG Orthology (KO) [BR:enr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:enr02044]
    H650_00845
Secretion system [BR:enr02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   H650_00845
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: AGN83772
UniProt: R9VFZ6
Position
37928..39799
AA seq 623 aa
MDSKLLEYYNRELAWLREMGQEFAARYPKVAGRLGMRGMDVSDPYVERLMEGFAFLTSRV
QLKMDAEFPRFSQRLLEMVAPNYLAPTPSMAIAELQPDSAKGDLSNGFVVPRGTMMDSQV
MKKNGVTCSYTTAHDVTLLPLKISQVELGGVPADLPLAQVGLSQRGAQSALRIRLSCDGP
VNLSHLDFDRLEFFLSGPDMQALKLLELVMEHQVGILCQANGQKTPPLVLADDALRQEGF
SADQALLPDDLRNFDGYRLLQEYFAFPSRFLFISLHGLRTMLTQSGEAKSFDIIILLDKA
DAQLERVVDKSHLALHCTPVINLFPKVAERQKLSDSLHEYHLVVDNIRPLDYEIYAVTKI
HASIDGQRDEQTFRPFWSSWSQDEGNYGAYFSLRREQRALSEHAQRYGTRTGYIGSEVFA
SLVDEQHAPWREELRYITAEVLCTSRDLPLMLQQEIGQFVLPDSLPVKTLQLRKGPTPPR
PALAEGLSTWRLISQLQMNYLSLMDGEDGEGAAALRQLLGLYTRLAEAPVARQIEGVRHC
VLEPVHRRVPEPGPIVFARGIGITLTVDEQAFSGFSPYLFGSVLERVFARLVGMNSFTEF
TLKSQQRGEVGYWPPRMGKRALI
NT seq 1872 nt   +upstreamnt  +downstreamnt
atggacagcaaattactcgaatattacaaccgcgaactggcctggctgcgcgaaatgggt
caggaattcgccgcacgctacccgaaagttgccgggcgtctgggtatgcgcggcatggac
gtctccgatccgtatgtcgaacgcctgatggaaggttttgcctttctgacctcgcgcgtg
cagttaaaaatggacgccgagttcccgcgtttctcccagcgtttgctggaaatggtcgcg
ccgaattaccttgcgcccacgccgtccatggcgattgccgaactgcaaccggacagcgcg
aaaggcgatttgagcaacggttttgtggtgccgcgcggcaccatgatggacagccaggtg
atgaaaaagaacggcgtcacctgtagctacaccaccgcacatgatgtcacgctgctgccg
ctgaaaatcagccaggtggaactgggcggtgtgcccgccgatctgccgctggcgcaggtt
ggtttaagccagcgcggggcgcaaagcgcactgcgtattcgcctgagttgcgacggcccg
gtaaacctcagccatcttgatttcgaccgtctggagttcttcttaagcggcccggatatg
caggcgctgaagctcctcgagctggtgatggagcatcaggtcggcattctgtgccaggcg
aacgggcagaaaaccccgccgctggtgctggccgacgatgcgctgcgccaggaagggttc
agcgcagaccaggcactgctgccggacgatttgcgcaattttgacggctaccgcctgttg
caggagtactttgcttttccgtcgcgtttcctgtttatcagcctgcatggcttgcgcacg
atgctgacgcaaagtggcgaagcgaagtccttcgatatcatcattctgctcgacaaagcc
gatgcgcagcttgaacgggtggtggataagagccacctcgcacttcactgcacgccagtg
attaacctgttcccgaaagtggcggaacgccagaaacttagcgacagcctgcatgagtac
catctggtggtcgataacatccgtccgctggattacgagatctacgccgttaccaaaatt
cacgccagcatcgacggtcagcgtgatgaacaaacatttcgcccgttctggagtagctgg
agccaggacgaaggtaactacggggcttacttttcgctgcgccgtgaacagcgtgcgtta
tcggaacatgcgcagcgttacggcacgcgtaccggctacatcggttcggaagtgttcgcc
tcgctggtggatgaacagcatgcgccgtggcgggaagagttacgctacatcaccgccgaa
gtgctgtgcaccagccgcgacttgccgctgatgttgcagcaggagattggtcagtttgtg
ttgccggattcgctgccggttaaaacattacaactgcgcaaaggcccgacaccgccgcgt
ccggcgctggcagaaggattgagcacctggcggctgatcagccagttgcagatgaactat
ttaagcctgatggatggcgaagacggtgaaggcgctgcggcgctgcggcagttgctgggg
ctttatacccggctggcggaagcaccggtcgcgcgtcagatcgaaggcgtgcgccactgc
gtgcttgaaccggtgcatcgccgcgtgccggaaccgggaccgattgttttcgcgcgcggt
attggcattaccctgacggtcgatgagcaggcgttctccggcttcagtccgtacctgttt
ggcagcgtgctggagcgcgtttttgcccgtctggtgggcatgaacagctttaccgagttc
acgcttaagagccagcagcgcggggaagtgggttactggccgccgcgcatgggcaagagg
gcgctgatatga

DBGET integrated database retrieval system