KEGG   Enterobacter sp. R4-368: H650_04215Help
Entry
H650_04215        CDS       T02700                                 

Definition
(GenBank) BglX
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
enr  Enterobacter sp. R4-368
Pathway
enr00460  Cyanoamino acid metabolism
enr00500  Starch and sucrose metabolism
enr01100  Metabolic pathways
enr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:enr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    H650_04215
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    H650_04215
Enzymes [BR:enr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     H650_04215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 Glyco_hydro_3_C Fn3-like CARDB DUF1707
Motif
Other DBs
NCBI-ProteinID: AGN84430
UniProt: R9VM11
Position
complement(766216..768588)
Genome map
AA seq 790 aa AA seqDB search
MTAIYQDANRPVAERVADLLARMTPEEKFAQMHALWLVLSEEGEHRERTDLSDEFAGVST
QAALAQRLKLGVGQITRPLGTHIVEAKRGVRAANRLQKTLVEETRLGIPALFHEECLVGL
LCKDATLFPSSLNYGSTWDPQLVQRAAHHIGLEARSTGCKQGLAPVLDVSRDVRWGRTEE
TFGEDPWLVGVMACAYVNGLQGEKGDMLATLKHYVGHSFSEGARNHAPVHLGFCELNDTF
LLPFEMAVKLAKAGSVMPAYHDIDNQPGHSDHFLLTTLLREQWGFEGIIVADYGGVSLLH
QHHGVTHDAAESAALSFNAGLDVELPKDDCARHLAEAVERGLISMAKVDEIVARVLAVKF
RLGLFEQPYTDEQGIDLQSARTRRVAREVATRSMTLLENNGILPLNGSPKVAVIGPTADD
PLALLSGYSFPVHLIISDMLEETTQVTTPLAALRQTLGEGNVRYAKGCHIIEKRMAGAPV
FPGDASGKPMQQSPVSRDLSLIPHAVSVAQESEVIIACVGDLAGLFQSGTVGEGSDTDSL
TLPGVQQQLLEALVATGKPVVVVMTGGRPYNLQGLESRVAAWLMAWAPGQEGGRAIADVL
TGRAEPQGRLVVSVPKSAGAMPYYYNHKLKSGGTPFAFHFGALYPFGYGKSWTQFEYMNP
VLLTPDVAIDDDIRVQVQVKNSGDRSGSEVVQLYVRDKVASMVRPVQELKAFQRVALSPG
ETATLTFIVPVDMLNFTRRDGQRIVEPGEFELQIGASSADIRAALTVNVYGETRELPTAW
KMMSQCEVSQ
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
atgactgctatctaccaggacgcaaaccgtcccgtggccgaacgcgttgcggatttactg
gcgcggatgacgccggaagagaaattcgcgcaaatgcatgcgttgtggctggtgctttca
gaagagggagagcaccgcgagcgcaccgatctcagcgatgagtttgccggtgtcagcacg
caggcggcgctggcacagcggcttaaactgggggtcgggcaaataacccgtccactgggc
acgcatattgtggaggcgaagcgcggtgtacgtgcggctaatcggctacaaaaaacgttg
gtggaagagacgcggttgggtatccccgcgctgtttcatgaagagtgcctggtgggttta
ttgtgcaaagacgcgacgttatttccctcctcgctgaactacggttccacctgggatccg
caacttgtgcaacgtgccgcccatcatatcgggctggaagcgcgatcgaccggatgcaaa
caggggctggctccggtactggatgtctcgcgcgatgtgcgctgggggcgcacggaagag
acgtttggtgaagatccgtggctggtgggggtgatggcgtgcgcctacgtgaacgggttg
cagggtgaaaagggcgatatgctggcgacgctcaaacactatgttggccactcgtttagc
gaaggcgcgcgtaaccatgccccggtacacctcggcttttgcgagctgaacgacaccttt
ttgctgccgttcgagatggcggtgaagctggcgaaagcaggatcggtgatgccagcctat
cacgacattgataaccagccgggtcacagtgaccatttcttgctcaccactttgctgcgt
gaacagtggggcttcgagggcattattgttgccgattacggtggcgtcagcctgctgcat
cagcatcacggcgtgacacacgatgccgcggaatccgctgcgctctcgtttaatgccggg
ctggatgttgaattgccaaaagatgactgtgcacgccatctggcagaggccgttgagcgt
ggacttatctccatggcaaaagtggacgaaattgtcgcccgcgtgttggcagtgaaattc
cgcctcggtttgttcgaacagccttataccgatgaacagggtatcgacctgcagtctgcc
aggacgcggcgggtagcgcgcgaggtcgctacgcgctcaatgacgctgctggaaaataac
ggcattctgccattgaacggctcaccgaaagtggcggtaattggcccgaccgctgacgat
ccgctggctttgctcagcgggtacagtttcccggtgcatttgatcattagcgatatgctg
gaggagaccacgcaggtcaccacgccgcttgcggcgctgcgccagacgctgggcgagggg
aacgtccgttatgccaaaggctgccatattattgaaaaacgtatggctggcgcccccgtt
ttccccggggatgcgtcggggaaaccgatgcagcagtcaccagtttccagggatttgagc
ctgatcccgcacgcggtgagcgtggcgcaggaaagcgaggtgatcattgcctgtgtgggc
gatcttgccgggctgttccagagcgggacggtgggagaaggttccgacacggacagcctg
acgctgccgggtgtgcaacaacagttgctggaggcgttagtggcaaccgggaaaccggtc
gtggtggtcatgaccggtgggcgtccgtataacctgcaagggctggagtcgcgcgttgcc
gcatggttaatggcgtgggcgccggggcaggagggcggccgggcgattgccgatgtattg
accgggcgggcagagccgcaggggcgtctggtcgtcagcgtgccgaaaagcgcgggggcg
atgccctattattacaaccacaagctgaaaagcggtggtacaccgtttgccttccatttt
ggcgcactttacccctttggctacgggaagagctggacgcagttcgagtatatgaacccg
gtattactgacacctgatgtggcgattgatgacgatattcgtgtgcaggtgcaggtaaaa
aatagcggagatcgcagcggcagcgaggtggtgcaactgtatgtccgggataaagtagcg
tcaatggtgcgtccggtgcaggagctaaaagcgttccagcgcgtggcattatcaccgggt
gaaacggcaaccctgacgttcatcgtgccggtggatatgctcaactttacgcgccgtgac
gggcagcgcattgtcgaaccgggtgagtttgagctgcaaatcggtgcctcatcggcagat
atccgcgcagcgctcacggtgaacgtttacggcgagacccgcgaacttcccaccgcctgg
aaaatgatgagtcagtgcgaagtcagtcagtga

DBGET integrated database retrieval system