KEGG   Enterobacter sp. R4-368: H650_04265Help
Entry
H650_04265        CDS       T02700                                 

Gene name
btuE
Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
enr  Enterobacter sp. R4-368
Pathway
enr00480  Glutathione metabolism
enr00590  Arachidonic acid metabolism
enr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:enr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    H650_04265 (btuE)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    H650_04265 (btuE)
Enzymes [BR:enr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     H650_04265 (btuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AGN84440
UniProt: R9VM21
Position
complement(779055..779606)
Genome map
AA seq 183 aa AA seqDB search
MQQDILNTEVKTIDGEQTTLAGYHGKVLLLVNVASKCGLTPQYEQLEQMQKEFESEGFTV
LGFPCNQFLGQEPGSEEEIKTFCSTTYGVTFPLFSKIDVNGEARHPLYKKLVAAAPKAVA
PQGSGFYERMESKGRAPKEPGDILWNFEKFLIGRDGKVIQRFSPDMTPEDPILVDAVKQA
LAK
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaggatattctcaatactgaagttaagactatcgatggcgagcagacaacgctt
gccggttaccacggcaaggtgctgctgttggtcaacgtcgcctcgaaatgtgggctgacg
ccgcagtacgaacagctggagcagatgcaaaaagaatttgaaagtgaaggttttaccgta
ctcggtttcccctgcaatcagtttctcggccaggaaccgggttcagaagaggaaattaaa
accttctgtagcaccacgtatggcgtaacatttccgctgttcagcaaaatcgatgtgaat
ggcgaagcacgtcacccgctgtataaaaagctggttgccgcagcgccgaaggccgttgca
cctcagggcagcggtttctacgaacgtatggagagcaaaggtcgtgcgccgaaagagccg
ggcgatattctgtggaattttgaaaaattcctgattggtcgtgacggcaaggtgattcaa
cgtttctctccggatatgacaccagaagatccaattctcgttgacgcggtaaaacaggcg
ctggcgaagtaa

DBGET integrated database retrieval system