KEGG   Enterobacter sp. R4-368: H650_09425Help
Entry
H650_09425        CDS       T02700                                 

Definition
(GenBank) glycosyl hydrolase family 32
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
enr  Enterobacter sp. R4-368
Pathway
enr00052  Galactose metabolism
enr00500  Starch and sucrose metabolism
enr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:enr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    H650_09425
   00500 Starch and sucrose metabolism
    H650_09425
Enzymes [BR:enr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     H650_09425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: AGN85374
UniProt: R9VJX5
Position
1832842..1834251
Genome map
AA seq 469 aa AA seqDB search
MASQPLLPAILQAVMKGLPKALNDSHYPGWHLAPATGLLNDPNGFIHFAGRYHLFYQWNA
LGCQHQHKCWGHWSSEDLVHWQHEPVALMPDEEYDRSGCYSGSAVDNNGVLTLCYTGNVK
FDDGTRTAWQCLAVQNSAGGFDKLGPAIPLPHGYTGHVRDPKVWRHGDYWYMVLGAQDLQ
LQGKVLLLRSENLWNWQNLGEIAGSGLGGLGEAGYMWECPDMFTLNGSTFLICCPQGIAR
EEKRYLNTYPSTYLSGQLDYASASYQHGDFHELDAGFEFYAPQTTLSADGRRLLVGWMGV
PDGEEMRQPTVANGWIHQMTCLRELSSRNGKLYQQPVRELQALRGDQQHYRGTAHKMPVL
DAQRLELVLESAGGITLDFADTLRLEWRHDELRLSRRSLENGAWQHRYWNGCAHKLQILC
DHSSVEIFINDGEGVMSSRYFPAHPAQITLTGDAEVQASYWSLRACMVE
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggcttcacaaccgctgctacccgccattttacaggcggtgatgaaaggtctaccgaag
gcgctgaatgacagccactaccccggctggcacctggcgccggccaccgggctgctcaac
gatccaaacgggtttatccactttgccgggcgctaccacctgttctaccagtggaatgcg
ctgggctgccagcaccagcacaagtgctgggggcactggagttcagaggacttagtgcac
tggcagcatgaacctgtcgccttgatgcccgatgaagagtacgaccgcagcggttgttat
tccggcagcgctgttgataacaatggcgtcctgacgctttgttataccggcaatgtgaaa
tttgatgatggcacgcgcaccgcgtggcaatgcctggcggtgcaaaacagcgcgggcggc
ttcgacaagctcggcccggcgatccccctgccgcacggctacaccggccacgttcgcgac
ccgaaagtgtggcgccacggcgactattggtacatggtactgggcgcgcaggacctgcaa
ttgcagggcaaagttttactcctgcgttccgaaaacctctggaactggcaaaaccttggc
gaaatcgccggtagcgggctgggtggattaggtgaagcgggctacatgtgggagtgcccg
gacatgttcacccttaacggcagtacgtttttaatctgctgtccgcaggggatcgcgcgg
gaagagaagcgttatctcaacacttacccaagcacttacttaagcggtcagctcgactac
gccagtgcaagctatcagcacggcgactttcacgaactggacgctgggtttgagttttat
gccccacaaaccacgctcagcgccgacgggcgccgcttgctggtaggctggatgggcgtg
ccggacggcgaagagatgcgccagccgaccgttgccaacggttggatccaccagatgacc
tgcctgcgtgagctgtcctcgcgcaacggaaaactctatcagcaaccggtcagggagttg
caggcactgcgtggtgatcagcaacattatcgcggcacagcgcacaagatgcccgtgctg
gatgcgcagcgcctggaactggtgctggaaagtgcgggtggcataacgctggatttcgcc
gatacgctgcgcctcgaatggcggcacgatgaactgcgtctttcacgtcgcagtctggag
aacggcgcgtggcagcaccgttactggaacggttgcgcgcataagttgcagatcctttgt
gaccactccagcgtcgaaatctttatcaacgatggcgaaggggtgatgagcagccgctac
ttcccggcccatccggcgcaaataaccctgacgggagacgcagaagtgcaggccagctac
tggtcgttacgtgcttgcatggtagaataa

DBGET integrated database retrieval system