KEGG   Enterobacter sp. R4-368: H650_10500Help
Entry
H650_10500        CDS       T02700                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
enr  Enterobacter sp. R4-368
Pathway
enr00071  Fatty acid degradation
enr00280  Valine, leucine and isoleucine degradation
enr00310  Lysine degradation
enr00362  Benzoate degradation
enr00380  Tryptophan metabolism
enr00620  Pyruvate metabolism
enr00630  Glyoxylate and dicarboxylate metabolism
enr00640  Propanoate metabolism
enr00650  Butanoate metabolism
enr00900  Terpenoid backbone biosynthesis
enr01100  Metabolic pathways
enr01110  Biosynthesis of secondary metabolites
enr01120  Microbial metabolism in diverse environments
enr01130  Biosynthesis of antibiotics
enr01200  Carbon metabolism
enr01212  Fatty acid metabolism
enr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:enr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    H650_10500
   00630 Glyoxylate and dicarboxylate metabolism
    H650_10500
   00640 Propanoate metabolism
    H650_10500
   00650 Butanoate metabolism
    H650_10500
  09103 Lipid metabolism
   00071 Fatty acid degradation
    H650_10500
   00072 Synthesis and degradation of ketone bodies
    H650_10500
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    H650_10500
   00310 Lysine degradation
    H650_10500
   00380 Tryptophan metabolism
    H650_10500
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    H650_10500
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    H650_10500
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    H650_10500
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:enr04147]
    H650_10500
Enzymes [BR:enr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     H650_10500
Exosome [BR:enr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   H650_10500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AGN85576
UniProt: R9VMV5
Position
complement(2048011..2049192)
Genome map
AA seq 393 aa AA seqDB search
MKDVVIVGAVRTPIGCFQGALSRLSAVELGSQVVRALIERSGVQPQDIDEVILGQVLTAG
AGQNPARQSAIKGGLPNTVSAITINDVCGSGLKALHLASQAIQCGEADVVIAGGQENMSR
APHVLTDSRTGAQLGNSQLIDSLVHDGLWDAFNDYHMGVTAENLAREYGISRERQDEWAL
SSQHKARVAIDSGRFRDEIVPVSALDAAGQTQVIDTDEQPRTDPSAEALAKLAPAFEQSG
SVTAGNASPINDGAAAVLVMSEAKAQELNLPVLARIRAFASVGVDPALMGIAPVYAMRRC
LERAGWQLDDVDLIEANEAYAAQALSVGKILEWDEKRVNVNGGAIALGHPIGASGCRILV
SLVHEMQKRQARKGLATLCIGGGQGVALAIERD
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgtcgtgatagtcggcgcggttcgcacgcctatcggctgttttcagggcgca
ttgtcacgcctctctgccgttgagttgggcagccaggtggtgcgcgcattgattgagcgt
agcggcgtgcagccacaagatatcgacgaagtgattttaggccaggtgctgacagcaggc
gccgggcaaaaccctgcgcggcagtcggcgatcaaaggcggcctgccgaatacggtttcg
gcaatcaccattaatgacgtctgcggctccgggctgaaagctctgcacctggcctctcag
gcgatccagtgcggcgaagccgatgtggtgatcgccggtgggcaggagaatatgagccgt
gcgccgcatgtgctgaccgacagccgcaccggcgcgcagctcggcaacagccagcttatt
gatagcctggtgcatgacgggttgtgggacgccttcaacgattatcatatgggcgtaacg
gcggaaaacctggcgcgtgaatatggcatcagccgtgaacgccaggatgaatgggcgtta
agctcgcagcataaagcgcgtgtcgctatcgattccgggcgttttcgcgatgaaattgtg
ccggtaagtgcgttggatgcagcaggccagacgcaggttatcgataccgatgaacaaccg
cgtaccgaccccagcgcggaagcgctggcgaaactcgcccccgcttttgaacaaagcggc
tccgtcaccgccggtaacgcctcgccgatcaatgacggtgcggcggcggtgctggtaatg
agcgaagcaaaagcgcaggaactgaatttaccggtgctggcgcgcatccgcgcgtttgcc
agtgtcggcgtcgacccggcgttaatgggcattgcgccggtttatgccatgcgccgctgc
cttgagcgcgcgggctggcagctcgatgatgtcgatctgattgaagcgaacgaagcctat
gcggcgcaggcgctgtcggtcggtaaaatccttgaatgggacgagaagcgggtgaatgtc
aatggcggggcgatagcgcttggccacccgattggcgcttccggctgtcgtattctggtt
tcgctggtgcatgaaatgcaaaaacggcaggcccgtaaagggctggcaaccttatgcatc
ggcggtggccagggcgtggcgctggcaatcgaacgcgattaa

DBGET integrated database retrieval system