KEGG   Enterobacter sp. R4-368: H650_11235
Entry
H650_11235        CDS       T02700                                 

Definition
(GenBank) Hcp family type VI secretion system effector
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
enr  Enterobacter sp. R4-368
Pathway
enr03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:enr00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    H650_11235
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:enr02044]
    H650_11235
Secretion system [BR:enr02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   H650_11235
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: AGN85718
UniProt: R9VQB0
Position
complement(2206448..2206939)
AA seq 163 aa
MAIPVYLWLKDDGGADIKGSVDVQDREGSIEVVAQQHNLYIPTDNNTGKLTGTRIHTPFL
FTKEIDSSSPYLYKAVTTGQTLKSAEFKWYKINDAGQEVEYFNTTLENVKVVKVNPVMHD
IKDPSYEKHNHLEQIELRYEKITWTYKDGNIIHSDSWNERATA
NT seq 492 nt   +upstreamnt  +downstreamnt
atggcaattcccgtttacctttggctgaaagatgacggcggcgcggacattaaagggtct
gtggatgtccaggatcgcgaaggcagcatcgaagtcgttgcacagcagcacaacctgtac
atcccgacggacaacaacaccggcaagctgaccggtacccgtatccacaccccgttcctg
tttacgaaggaaatcgattcttccagcccgtatctgtacaaggcggtgacgaccggccag
accctgaagtctgctgaattcaagtggtacaaaatcaacgacgcgggtcaggaagtggag
tacttcaacaccactctggaaaacgtgaaagtggtgaaagtgaatccggtgatgcacgac
atcaaagatccttcttacgagaagcacaaccacctcgaacagatcgaactgcgctacgaa
aaaatcacctggacctacaaagacggcaacatcattcattccgattcctggaacgaacgc
gccaccgcgtaa

DBGET integrated database retrieval system