KEGG   Enterobacter sp. R4-368: H650_11260
Entry
H650_11260        CDS       T02700                                 

Definition
(GenBank) hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
enr  Enterobacter sp. R4-368
Brite
KEGG Orthology (KO) [BR:enr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:enr02044]
    H650_11260
Secretion system [BR:enr02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   H650_11260
SSDB
Motif
Pfam: T6SS_VipA GerD
Other DBs
NCBI-ProteinID: AGN85723
UniProt: R9VQB4
Position
complement(2212291..2212788)
AA seq 165 aa
MSDSFQREIPKARINLKLDLHTGGAQKKTELPLKLLVTGDFSNGQETASLSERVKVNVNK
NNFNSVLSDYSPKVNLVVENTLAGNGSEENISLTFRDMKDFTPEEVARQIPQLKAMLAMR
NLLRDLKANLLDNQTFRKELEKILLNPSLSAELRDELSSLAPKQP
NT seq 498 nt   +upstreamnt  +downstreamnt
atgagcgatagcttccagcgggagataccgaaagcacgtatcaacctgaaactcgacctg
catacgggcggagcacagaaaaaaacagaattaccgttgaaattactggtgacgggtgat
tttagtaatgggcaggaaacggcgtctttaagcgaacgcgttaaagtcaacgttaataaa
aataactttaatagtgttctttctgattattccccaaaagttaaccttgttgttgaaaat
accctggcgggtaatggtagcgaagagaatatcagcttgacgttccgcgatatgaaagat
ttcacgccagaagaggttgcccgccaaattccccagctcaaagctatgttggcaatgcgc
aatctgcttcgcgatctgaaagcgaacttactcgataatcagactttccgaaaggaatta
gaaaaaattcttcttaacccctctctcagcgcagaactgcgtgatgagctctcctctctt
gcgcccaaacagccataa

DBGET integrated database retrieval system