KEGG   Enterobacter sp. R4-368: H650_15830Help
Entry
H650_15830        CDS       T02700                                 

Gene name
gldA
Definition
(GenBank) glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
enr  Enterobacter sp. R4-368
Pathway
enr00561  Glycerolipid metabolism
enr00640  Propanoate metabolism
enr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:enr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    H650_15830 (gldA)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    H650_15830 (gldA)
Enzymes [BR:enr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     H650_15830 (gldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase
Motif
Other DBs
NCBI-ProteinID: AGN86545
UniProt: R9VT09
Position
complement(3135751..3136854)
Genome map
AA seq 367 aa AA seqDB search
MDRIIQSPGKYIQGADVITRLGDYLKPLADRWLVVGDKFVLGFAQETLQKSLVDAGLACE
IAPFGGECSQNEIDRLRGVAESARCGAVLGIGGGKTLDTAKALAHFMHVPVAIAPTIAST
DAPCSALSVIYTDSGEFDRYLLLPNNPDRVIVDTKIVAGAPARLLAAGIGDALSTWFEAR
ACSRSGAKTMAGGQCTQSALALAELCYNTLLEEGEKAMFAAEQHVVTPALERVVEANTYL
SGVGFESGGLAAAHAIHNGITAIPEAHHYYHGEKVAFGTLTQLVLENAPLEEIETVAALC
HTVGLPITLAQLGIKTDIPEKMRIVAQAACAQGETIHNMPGGATADQVYAALLVADQYGQ
RFLEEWE
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggaccgcatcattcagtcgccgggcaagtatatccagggtgcagacgttatcacccgc
ctcggtgactatctcaaaccgctggccgatcgctggctggtggtcggtgacaaatttgtt
ctcggttttgcgcaggaaacgctgcaaaaaagcctggtggatgccgggctggcctgcgaa
atcgcgccgttcggcggcgaatgttcacaaaacgaaattgaccggctgcgcggtgtggca
gaaagcgcccgctgcggcgcggtactcggcatcggtggcggtaaaacgctggatactgcc
aaagcactggcgcatttcatgcacgtgccggtggcgattgcccccactatcgcatcgacc
gatgcgccctgtagcgcgctgtcggttatctacaccgacagtggtgagttcgaccgttat
ttgctgctgcccaacaacccggatcgggtgattgtcgacaccaaaattgtcgccggagcc
cctgcgcgtttgctggcagccgggatcggtgatgcactctcgacctggtttgaagcgcgt
gcttgttcacgcagcggcgcaaaaaccatggcgggcggtcaatgtacgcaatccgccctc
gcgctggcggagctgtgttacaacacgctacttgaagagggtgaaaaagcgatgttcgcc
gccgaacagcatgtggtgacgcctgcgctggagcgcgtggtggaagccaatacctacctc
agcggtgtcggttttgagagtggcggtctggcggcagcacacgccattcataacggcatc
acggcaattccggaagcgcatcattactaccatggcgaaaaagtggcgtttggcacctta
actcaactggtactggaaaacgcgccgctggaagagatcgaaaccgtcgccgccctgtgt
cataccgtgggtttgccaattacgctggcgcaactggggattaaaactgacattccagag
aaaatgcgcatcgtggcgcaggctgcctgtgcacaaggggaaaccattcacaatatgccg
ggcggtgcgacagcggatcaggtctatgccgcgctactggtagccgatcagtacgggcag
cgttttcttgaagagtgggaatag

DBGET integrated database retrieval system