KEGG   Enterobacter sp. 638: Ent638_0135Help
Entry
Ent638_0135       CDS       T00507                                 

Definition
(GenBank) D-mannitol 1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
ent  Enterobacter sp. 638
Pathway
ent00051  Fructose and mannose metabolism
ent01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ent00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Ent638_0135
Enzymes [BR:ent01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     Ent638_0135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ABP58825
UniProt: A4W545
Position
complement(152148..153311)
Genome map
AA seq 387 aa AA seqDB search
MKVNTMKALHFGAGNIGRGFIGKLLADAGITLTFADVNQVVLDALNARHSYDVHVVGENE
QVETVSGVNAVSSIGDDVVDLIASVDLVTTAVGPVVLERIAPAVAKGLAKRKAQGNNTPL
NIIACENMVRGTTQLKGHVLAAVADEDKAWVEEHVGFVDSAVDRIVPPSESATNDPLEVT
VETFSEWIVDKTQFKGTLPAIPGMELTDNLMAFVERKLFTLNTGHAITAYLGKLAGHQTI
RDAILDEKIRAVVKGAMDESGAVLIKRYGFDAEKHAAYIQKILGRFENPYLKDDVERVGR
QPLRKLSAGDRLIKPLLGTLEYGLPHANLVKGIAAAMHYRSEQDPQAIELAELIDTKGPQ
DALAQLSGLEAKSDVVLEAVNAYNATK
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttaatacgatgaaagcattacattttggcgcaggtaatatcggtcgtggcttt
atcggcaaactgctggcagacgcgggcattacgctaacattcgccgatgtgaatcaggtg
gtgctcgacgccctgaatgcccgtcatagctacgatgttcacgttgtcggcgaaaacgaa
caggtcgaaaccgtctcaggcgtcaacgctgttagcagcattggcgatgacgttgtagac
ctgatcgcaagcgtcgatctggtgaccaccgccgttggcccggtggtgcttgagcgcatc
gcccctgccgtcgcaaaaggcctcgcaaaacgtaaagcacagggcaataacacgccgctg
aacatcatcgcctgtgaaaacatggtgcgcggtacgactcaactaaaaggccatgttctg
gccgccgtggcggatgaagacaaagcctgggttgaagagcacgtcggttttgttgattcc
gccgttgaccgcatcgttcccccatccgagtctgcaacaaacgatccgctggaagtgacc
gttgaaaccttcagcgagtggatcgtcgataaaacccagttcaaaggcacgctgccagct
attccgggaatggaattgacggataacctgatggcctttgtcgaacgcaaactcttcacg
ctgaacaccgggcatgctataaccgcgtacctcggaaaattggccggtcatcaaaccatt
cgtgacgcgattctcgatgagaaaatccgcgctgtggtaaaaggtgcaatggacgagagc
ggcgcggtcctgatcaaacgctacggttttgatgctgagaaacatgcggcatacattcag
aaaatcctcggtcgttttgaaaacccgtatctgaaagatgacgttgagcgcgttgggcgt
cagccgctgcgtaaactcagcgcgggcgaccgtctgatcaagccgctgctgggcacgctg
gaatacggtttgccgcacgccaatttggtgaaaggtatcgccgctgccatgcattatcgc
agcgagcaagatccgcaggcgattgagctggcagaattgattgataccaaaggcccgcaa
gatgcgctggcgcagctttctggtcttgaagcgaagagtgacgtagtgctggaggcggtt
aacgcatacaacgcgacgaaataa

DBGET integrated database retrieval system