KEGG   Enterobacter sp. 638: Ent638_0661Help
Entry
Ent638_0661       CDS       T00507                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ent  Enterobacter sp. 638
Pathway
ent00010  Glycolysis / Gluconeogenesis
ent00020  Citrate cycle (TCA cycle)
ent00620  Pyruvate metabolism
ent01100  Metabolic pathways
ent01110  Biosynthesis of secondary metabolites
ent01120  Microbial metabolism in diverse environments
ent01130  Biosynthesis of antibiotics
ent01200  Carbon metabolism
Module
ent_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ent00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ent638_0661
   00020 Citrate cycle (TCA cycle)
    Ent638_0661
   00620 Pyruvate metabolism
    Ent638_0661
Enzymes [BR:ent01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Ent638_0661
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H HlyD_D23 NQRA HlyD_3 DUF1223 DUF3597
Motif
Other DBs
NCBI-ProteinID: ABP59348
UniProt: A4W6L8
Position
748939..750825
Genome map
AA seq 628 aa AA seqDB search
MAIEINVPDIGADEVEITEILVKVGDKVEAEQSLITVEGDKASMEVPSPQAGIVKEIKIS
VGDKTETGKLIMIFDSADGAATAAPAQEEKKEAAAPAAAPAAAAAKDVNVPDIGGDEVEV
TEIMVKVGDTVAAEQSLITVEGDKASMEVPAPFAGVVKEIKINTGDKVSTGSLIMVFEVA
GSAPAAAPAKAEAAPAAAAPAASGAKDVNVPDIGGDEVEVTEVMVKVGDKVAAEQSLITV
EGDKASMEVPAPFAGTVKEIKISAGDKVSTGSLIMVFEVEGAAPAAAPAAAPAPAAAAPA
QASKAAAPAAKAEGKSEFAENDAYVHATPLIRRLAREFGVNLAKVKGTGRKGRILREDVQ
TYVKDAVKRAEAAPAATGGGIPGMLPWPKVDFSKFGEVEEVELGRIQKISGANLSRNWVM
IPHVTHFDKTDITDLEAFRKQQNAEAEKRRLDVKFTPVVFIMKAVAAALEQMPRFNSSLS
EDAQRLTLKKYINIGVAVDTPNGLVVPVFKDVNKKSITELSRELTVISKKARDGKLTAGE
MQGGCFTISSIGGLGTTHFAPIVNAPEVAILGVSKSAMEPVWNGKEFVPRLMMPISLSFD
HRVIDGADGARFITIINNTLSDIRRLVM
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgaaatcaatgtaccggacatcggggctgatgaagttgaaatcaccgagatc
ctggtcaaagtaggcgacaaagttgaagctgaacagtcgctgatcaccgtagaaggcgac
aaagcctctatggaagtcccgtctcctcaggctggcatcgtgaaagagatcaaaatctct
gttggcgataaaaccgagactggcaaactgatcatgattttcgattccgccgacggtgca
gcaactgctgcacctgcgcaggaagagaagaaagaagcggcagctcctgctgcggcacca
gcagcagcggctgcaaaagacgttaacgtaccggatatcggcggcgacgaagttgaagtc
actgagatcatggttaaagtcggcgacaccgttgcggctgaacagtccctgattaccgtt
gaaggcgataaagcctctatggaagtcccggctccgttcgcaggcgtggtgaaagagatc
aaaatcaacaccggcgacaaagtgtctaccggttccctgatcatggtcttcgaagtggcg
ggtagcgcacctgctgcggctccggctaaagcagaagcggcaccggctgcggctgcacca
gcggcctctggcgcgaaagacgttaacgttccggatatcggcggtgacgaagttgaagtg
actgaagtgatggtgaaagtgggcgacaaagttgccgctgagcagtcactgatcaccgta
gaaggcgacaaagcctctatggaagtcccggctccgttcgcaggtaccgtgaaagaaatt
aaaatcagcgctggcgacaaagtgtctaccggttctctgattatggtcttcgaagtggaa
ggcgctgcccctgcggcggctccggctgctgctccagcacctgctgctgccgcaccggcg
caagcttcaaaagcggctgcacctgctgctaaagcggaaggtaaatctgagttcgctgaa
aacgatgcttacgttcacgctactccgctgattcgccgtctggcacgcgagttcggcgta
aacctggcgaaagtgaaagggactggccgtaaaggtcgtatcctgcgcgaagacgttcag
acttacgtgaaagatgcggtgaaacgcgctgaagcggcacctgctgctaccggcggcggt
atcccgggcatgctgccatggccaaaagtggacttcagcaagtttggtgaagtggaagaa
gttgagctgggccgtatccagaaaatctctggtgcgaacctgagccgtaactgggtgatg
atcccgcacgttacgcacttcgacaaaactgatatcaccgatctggaagcgttccgtaaa
cagcagaacgcagaagctgagaagcgccgtctggatgtgaaattcacgccagtggtcttc
atcatgaaagcggttgctgcggcgcttgagcagatgccacgtttcaacagctctctgtct
gaagacgcgcagcgtctgacgctgaagaaatacatcaacatcggtgttgcggttgatacg
ccaaatggtctggttgttccagtcttcaaagacgtgaacaagaagagcattactgagctg
tcccgtgaactgaccgtgatttccaagaaagcgcgtgatggtaagctgactgccggcgaa
atgcagggcggttgcttcactatctccagcatcggcggcttgggtacaacccacttcgca
ccgatcgttaacgcgccggaagtggcaatcctcggggtttccaaatccgcgatggaacct
gtgtggaatggtaaagagttcgtgccgcgtctgatgatgccaatctctctttccttcgac
caccgcgtgatcgatggggctgatggtgcgcgctttatcaccatcatcaacaacaccctg
agcgacattcgccgcctggtgatgtaa

DBGET integrated database retrieval system