KEGG   Enterobacter sp. 638: Ent638_0711Help
Entry
Ent638_0711       CDS       T00507                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
ent  Enterobacter sp. 638
Pathway
ent00900  Terpenoid backbone biosynthesis
ent01100  Metabolic pathways
ent01110  Biosynthesis of secondary metabolites
ent01130  Biosynthesis of antibiotics
Module
ent_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:ent00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Ent638_0711
Enzymes [BR:ent01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Ent638_0711
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C PseudoU_synth_1
Motif
Other DBs
NCBI-ProteinID: ABP59398
UniProt: A4W6R8
Position
809010..810209
Genome map
AA seq 399 aa AA seqDB search
MKHLTLLGSTGSIGCSTLDVVRHNPEEYTVTALVAGKNVQRMVEQCLEFSPRYAVMDDEE
SARQVKALLADRGSCTEVMSGRQAACDMAALDDVDQVMAAIVGAAGLLPTLAAIDAGKTV
LLANKEALVTCGRLFMDAVKQRGARLLPVDSEHNAIFQSLPQPFQENLGYADLEQNGVVS
VLLTGSGGPFRETPLSELVSMTPDQACRHPNWSMGRKISVDSATMMNKGLEYIEARWLFN
ASAKQMEVLIHPQSVIHSMVRYQDGSVIAQLGEPDMRTPIAHSMAWPNRVMSGAKPLDFC
ALSALTFSEPDYDRYPCLKLAMNAFDQGQAATTALNAANEITVEAFLKQQIRFTDIAALN
LSVLEEMDLREPQSVEEVLAVDSQARMAARKAVTHLASR
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaagcatttaactctcctcggctcgaccggctctattggttgcagcactctcgacgtt
gttcgccacaatcctgaagaatacacggtgaccgcccttgtggccgggaaaaacgtgcag
cgcatggttgaacaatgtcttgagttctctccccgttatgcggtgatggatgacgaggaa
agtgctcgccaggttaaagcgttgctggcggatcggggaagttgtacagaagtcatgagt
gggcgacaagccgcgtgtgatatggctgcgctggatgacgtcgatcaggtgatggcggcc
attgtgggcgcagcagggcttttgcccacgctcgcggcaattgacgccgggaaaaccgtt
ttactggcaaataaagaggcactcgtgacatgcggacgcctttttatggatgccgtaaaa
cagcgaggcgcgcgacttttaccggtggatagcgaacataacgcgatttttcagagttta
ccgcaaccttttcaggaaaacctagggtacgctgatcttgagcaaaatggcgttgtgtcc
gttttgctcaccgggtctggtggcccgttccgtgaaacgccattgtctgaactggtctca
atgacgcccgatcaggcatgccgtcatccgaactggtcgatggggcgaaaaatctctgtc
gactcagccaccatgatgaataaaggtctggaatacattgaagcccgctggttatttaac
gcgtctgcaaaacagatggaagtgttgattcacccgcagtcggtgattcactccatggtg
cgctatcaagatggcagcgtaattgcgcagttgggtgaaccggatatgcgtacgccaatc
gctcattcgatggcgtggccaaaccgggtaatgtcgggagctaaaccactcgatttttgc
gcgctgagtgcactcactttcagcgaacctgactacgaccgttacccttgtctgaagctg
gcgatgaacgcttttgatcagggacaagcggcaacgacagcattgaatgcagctaacgaa
attacggttgaggcatttctgaaacagcagatccgctttacggatattgcggcgcttaat
ctgtcggttctcgaagagatggatttacgggaaccgcagagcgttgaagaagtgctggct
gtcgattcacaagctcgcatggcggcgcgtaaagcggtgacgcatctcgcaagccggtga

DBGET integrated database retrieval system