KEGG   Enterobacter sp. 638: Ent638_1074Help
Entry
Ent638_1074       CDS       T00507                                 

Definition
(GenBank) dihydropteridine reductase
  KO
K10679  nitroreductase / dihydropteridine reductase [EC:1.-.-.- 1.5.1.34]
Organism
ent  Enterobacter sp. 638
Pathway
ent00633  Nitrotoluene degradation
ent01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ent00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Ent638_1074
Enzymes [BR:ent01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     Ent638_1074
  1.-  
   1.-.-  
    1.-.-.-  
     Ent638_1074
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitroreductase TM1586_NiRdase
Motif
Other DBs
NCBI-ProteinID: ABP59755
UniProt: A4W7S5
Position
complement(1177689..1178342)
Genome map
AA seq 217 aa AA seqDB search
MDIISVARKRHSTKAFDPTFKLTAEQAEKIQTLLQFSPSSTNSQPWHFIVASTEEGKARV
AKSAAGTFVFNERKMLDASHVIVFCAKTEMDDAWLERVVDQEDADGRFNTPEAKAANHKG
RCYFADMHRVDLKDDDQWMAKQVYLNVGNFLLGVGALGLDAVPIEGFDAAILDAEFGLKE
KGFTSLVVVPVGRHSVEDFNASLPKSRLPLSTIITEC
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggatatcatttccgttgcccgcaagcgccactcaaccaaggcgttcgacccaacgttc
aaactgactgcagaacaagcagaaaaaattcaaactctgctgcaattcagcccgtccagc
accaactctcagccgtggcactttatcgtggccagcacggaagaaggcaaagcacgcgtc
gcaaaatcggcagcgggcactttcgtgttcaacgaacgcaaaatgctcgatgcatcccat
gtgatcgtgttctgcgccaaaaccgaaatggacgacgcatggcttgagcgcgtggtggat
caggaagacgccgatgggcgttttaacaccccagaagccaaagccgccaaccacaaaggc
cgctgctacttcgcggatatgcaccgcgttgatctgaaagatgacgatcagtggatggca
aaacaggtttacctgaacgtcggcaacttcctgctgggcgttggcgcactgggtctggac
gccgtaccgattgaaggcttcgacgccgcgatcctcgacgccgaatttggtctgaaagaa
aaaggcttcaccagcctggtggttgtgcccgtgggccgccacagcgtggaggatttcaac
gcctccctgccgaaatcccgcctgccgctgagcaccattatcaccgagtgctaa

DBGET integrated database retrieval system