KEGG   Enterobacter sp. 638: Ent638_1141Help
Entry
Ent638_1141       CDS       T00507                                 

Definition
(GenBank) acireductone dioxygenase apoprotein
  KO
K08967  1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
ent  Enterobacter sp. 638
Pathway
ent00270  Cysteine and methionine metabolism
ent01100  Metabolic pathways
Module
ent_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:ent00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Ent638_1141
Enzymes [BR:ent01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     Ent638_1141
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     Ent638_1141
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ARD Cupin_2 Cupin_1 AraC_binding
Motif
Other DBs
NCBI-ProteinID: ABP59822
UniProt: A4W7Z2
Position
complement(1256465..1257007)
Genome map
AA seq 180 aa AA seqDB search
MSALTIYSETETREPLWHSTDAAEIADKLNARGVRFERWEADRDLGQDPAAETVINAYQH
AIDKLVAEKGYQSWDVISLRADNPQKEALRAKFLNEHTHGEDEVRFFVEGAGLFCLHIDD
QVYQVLCEKNDLISVPAGTPHWFDMGSEPNFTAIRIFDNPEGWIAQFTGDAIADAYPRLP
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcattgaccatttattcggaaacagaaacccgtgagccgctgtggcacagtacc
gacgccgcagagattgccgataagctgaacgcgcgcggcgtgcgctttgagcgctgggaa
gccgaccgcgacttgggtcaggatccggcagcggaaacagtgatcaacgcttatcagcac
gcgattgacaaactggttgccgaaaaaggctatcagagctgggatgtgatcagcctgcgc
gcggacaatccgcagaaagaggcgctgcgcgccaaattccttaacgaacacacccacggc
gaagacgaagtgcgcttcttcgtggaaggtgcagggcttttctgcctgcatatcgatgac
caggtttatcaggtgctgtgcgagaaaaacgatctgatttcagtgcccgcgggcacaccg
cactggtttgatatgggctccgagccaaacttcaccgccatccgtattttcgataatccc
gaaggctggatagcccagtttaccggcgacgccatcgccgatgcctacccgcgactgcca
tag

DBGET integrated database retrieval system