KEGG   Enterobacter sp. 638: Ent638_1228Help
Entry
Ent638_1228       CDS       T00507                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ent  Enterobacter sp. 638
Pathway
ent00020  Citrate cycle (TCA cycle)
ent00640  Propanoate metabolism
ent00660  C5-Branched dibasic acid metabolism
ent01100  Metabolic pathways
ent01110  Biosynthesis of secondary metabolites
ent01120  Microbial metabolism in diverse environments
ent01130  Biosynthesis of antibiotics
ent01200  Carbon metabolism
Module
ent_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ent_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ent00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Ent638_1228
   00640 Propanoate metabolism
    Ent638_1228
   00660 C5-Branched dibasic acid metabolism
    Ent638_1228
Enzymes [BR:ent01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Ent638_1228
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ABP59909
UniProt: A4W879
Position
1354204..1355370
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFARYGLPAPVGYACNTPREAEEAASKIGSGPWVVKCQVHAGGRGKAGGV
KVVKSKEEIRAFAEHWLGKRLVTYQTDANGQPVNQILVEAATDIAKELYLGAVVDRSSRR
VVFMASTEGGVEIEKVAEETPHLIHKVAIDPLAGPMPYQGRELAFKLGLEGKLVQQFTKI
FMGLAKIFLERDLALIEINPLVITTQGDLICLDGKLGADGNALFRQSDLREMRDQSQEDP
REAQAAQWELNYVALDGNIGCMVNGAGLAMGTMDIVKLHGGEPANFLDVGGGATKERVTE
AFKIILSDDKVKAVLVNIFGGIVRCDLIADGIIGAVEEVGVNVPVVVRLEGNNAELGAKK
LADSGLNIIAAKSLTDAAQQVVAAVEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacatgaatatcaggccaaacagctgtttgcccggtatggcttaccggctccg
gtgggttatgcttgtaataccccacgcgaagcagaagaagccgcatctaaaatcggttcc
ggcccttgggtagttaagtgtcaggttcacgctggcggccgcggtaaagcgggcggcgtg
aaagtggttaagagcaaagaagagattcgtgcttttgccgagcattggcttggcaaacgc
ctggtgacgtatcaaacagatgcgaacggccagccggtcaatcagattctggtggaagcg
gcgaccgatatcgccaaagaattgtacctcggcgcagtggtagaccgtagctcacgtcgc
gtggtattcatggcgtctaccgaaggcggcgtggaaatcgaaaaagtagcggaagaaacg
ccgcatctgattcacaaagtggctatcgatccgctggcaggccctatgccttaccagggt
cgcgagctggcattcaaactgggtctggaaggtaaactggttcaacagttcaccaaaatc
ttcatgggcctggcgaagattttcctcgaacgcgatctggcgctgatcgaaatcaacccg
ctggttatcaccacgcagggcgacctgatctgcctcgatggcaaactcggcgctgacggt
aacgccctgttccgccagtctgacctgcgcgaaatgcgtgaccagtctcaggaagacccg
cgtgaagcgcaggctgcacagtgggaactgaactacgtggcgctggacggtaacatcggc
tgcatggttaacggtgcgggcctggcaatgggcaccatggacatcgttaaactgcacggc
ggcgagccggcaaacttcctcgatgtcggcggtggcgcgaccaaagagcgcgtgaccgaa
gcgttcaaaatcattctctctgacgacaaagtcaaagccgttctggtgaacatcttcggc
ggtattgtgcgttgcgatctgatcgctgacggcattatcggtgcggtcgaagaagtgggc
gtgaacgtcccggttgtggttcgtctggaagggaacaacgctgaactcggcgcgaaaaaa
ctggctgacagcggcctgaatattattgcagcgaaaagtctgacggatgcagctcagcag
gttgttgccgccgtggaggggaaataa

DBGET integrated database retrieval system