KEGG   Enterobacter sp. 638: Ent638_1386Help
Entry
Ent638_1386       CDS       T00507                                 

Definition
(GenBank) Threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
ent  Enterobacter sp. 638
Pathway
ent00260  Glycine, serine and threonine metabolism
ent01100  Metabolic pathways
ent01110  Biosynthesis of secondary metabolites
ent01120  Microbial metabolism in diverse environments
ent01130  Biosynthesis of antibiotics
ent01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ent00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ent638_1386
Enzymes [BR:ent01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     Ent638_1386
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Cys_Met_Meta_PP DegT_DnrJ_EryC1 Herpes_UL74
Motif
Other DBs
NCBI-ProteinID: ABP60067
UniProt: A4W8N7
Position
complement(1514644..1515645)
Genome map
AA seq 333 aa AA seqDB search
MIDLRSDTVTRPSRAMLEEMMAAPVGDDVYGDDPTVNELQRYAAELSGKEAALFLPTGTQ
ANLVALLSHCERGEEYIVGQGAHNYLYEAGGAAVLGSIQPQPIDAASDGSLPLDKVAAKI
KADDIHFARTKLLSLENTHNGKVLPREYLKAAWEFTRERNLGLHVDGARIFNAVVEYGCE
LKEITQYCDSFTICLSKGLGTPVGSLLVGDADYIKRANRWRKMTGGGMRQAGILAAAGLY
ALKNNVARLKDDHDNAAWMATQLREIGADVMRHDTNMLFIRVGDENAAALGEFMKSRGVL
INASPVVRLVMHLDVSREQLSDVVKHWQAFLQR
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgattgatttacgcagtgataccgttacccgtccgagtcgcgccatgcttgaagagatg
atggccgcgccggtcggggacgacgtgtacggtgatgacccaacggtcaacgaactccag
cgctacgccgcagaattaagcggtaaagaggcggcgctgttcctgcccaccggcacgcag
gccaatctggtggcattgctcagccattgcgagcgcggcgaagagtacattgttggccag
ggcgcgcataactatctgtacgaagcgggtggcgcagcggtgctcggcagcattcagccg
cagcctattgacgccgcgtctgacggctccctgccactggataaagtcgcggccaaaatc
aaagccgacgatattcacttcgcacggaccaaactgctcagtctggaaaatacccacaac
gggaaagtgcttccgcgcgaatatttaaaagccgcgtgggagtttacccgcgagcgcaat
ctgggattgcacgtcgacggtgcgcgcatctttaacgccgtggtggagtatggctgcgag
ctgaaagagatcacccaatactgcgattcgttcaccatttgtctttccaaaggtctggga
acgccggtcggctcgctgctggtgggcgatgcggattacatcaagcgcgccaatcgctgg
cgtaaaatgaccggcggcggcatgcgtcaggccggaattctggccgcggccggattgtat
gcgctgaaaaacaacgttgcgcgtctgaaagacgatcatgacaatgccgcgtggatggcg
actcaactgcgtgaaatcggcgcggacgtgatgcgtcacgacaccaatatgctgttcatt
cgcgtgggtgatgaaaacgctgccgcgctgggtgaattcatgaaatcccgtggcgtgctg
atcaacgcttccccagtagtgcgcctggtgatgcatctcgacgtgagccgcgaacagctt
tctgacgtggtcaaacactggcaggcctttttacagcgctaa

DBGET integrated database retrieval system