KEGG   Enterobacter sp. 638: Ent638_1468
Entry
Ent638_1468       CDS       T00507                                 

Definition
(GenBank) protein of unknown function DUF1047
  KO
K09911  uncharacterized protein
Organism
ent  Enterobacter sp. 638
Brite
KEGG Orthology (KO) [BR:ent00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    Ent638_1468
SSDB
Motif
Pfam: MatP MatP_C RHH_4 TMF_TATA_bd
Other DBs
NCBI-ProteinID: ABP60148
UniProt: A4W8W8
Position
1623989..1624444
AA seq 151 aa
MKYQQLENLESGWKWKYLVKKHREGELITCYIEASAAKEAVDLLLTLENEPVHVNSWIEK
HINPALLNRMKQTIRARRKRHFNAEHQHTRKKSIDLEFMVWQRLAGLAQRRGKTLSETVV
QLIEDAEHKEKYANQMSTLKNDLQAMLGKKE
NT seq 456 nt   +upstreamnt  +downstreamnt
atgaaatatcaacaactggaaaatctcgaaagcggctggaaatggaagtacctggtcaaa
aagcaccgtgaaggggagctgatcacctgctacatcgaagccagtgctgcaaaagaagcg
gtggatttattactgacactcgaaaacgaaccggtgcatgttaatagctggatagagaag
catatcaatccagcgttactgaaccgtatgaaacagaccatccgcgctcgccgcaaacgg
cactttaacgctgagcatcagcacactcgcaagaaatcaatcgatcttgagttcatggtc
tggcaacgattagcggggcttgctcaacggcggggtaaaacgctttctgaaacggttgta
cagttgattgaagatgcggagcacaaagagaaatatgccaaccagatgtctacgctgaaa
aacgatcttcaggcgatgctgggaaaaaaagagtga

DBGET integrated database retrieval system