KEGG   Enterobacter sp. 638: Ent638_2644Help
Entry
Ent638_2644       CDS       T00507                                 

Definition
(GenBank) mannose-6-phosphate isomerase, type 2
  KO
K00971  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
ent  Enterobacter sp. 638
Pathway
ent00051  Fructose and mannose metabolism
ent00520  Amino sugar and nucleotide sugar metabolism
ent01100  Metabolic pathways
ent01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ent00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Ent638_2644
   00520 Amino sugar and nucleotide sugar metabolism
    Ent638_2644
Enzymes [BR:ent01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     Ent638_2644
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase MannoseP_isomer Cupin_2 NTP_transf_3 CENP-C_C AraC_binding
Motif
Other DBs
NCBI-ProteinID: ABP61311
UniProt: A4WC81
Position
complement(2843464..2844891)
Genome map
AA seq 475 aa AA seqDB search
MSLFPVIMAGGSGSRLWPLSRVLYPKQFLCLEGNLTMLQATINRLHGIECESPVVICNEQ
HRFIVAEQLREMNKLTENIILEPVGRNTAPAIALAALATVNSQPNTSPIMLVLAADHVIQ
NENAFREAVLKALPLAEEGKLVTFGIVPNKPETGYGYIRRGDPSGDSEPVNAYKVAQFVE
KPNQETAESYVSSGEYYWNSGMFLFRADRYLEELNKYRPDILAACKKAMNVTNPDLNFIR
IDQEAFITCPDESVDYAVMEKTTDAVVVPLDAGWSDVGSWSSLWDISRKTPEGNVNTGDV
LSCNTENSFLYSESGLLATVGVKDLVVVQTKDAVLIADRNAVQDVKKIVEMIKSEGRLEH
HAHREVYRPWGKYDSIDTGERYQVKRLTVKPGEGISLQMHHHRAEHWIVVAGTAQVTIND
QSRLLGENESIYIPVGATHCLENPGKIPLELIEVRSGSYLGEDDIVRLADRYGRV
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgtcattattccctgttattatggccggcggttccggcagtcgtttatggccactttca
cgagttctctaccccaagcagtttctctgccttgagggtaacctcacaatgctacaagca
acaattaatagattgcacggtattgagtgcgaaagccctgtagtaatctgcaatgagcag
caccgctttatcgttgctgagcagttacgtgagatgaataaactcactgagaatattatt
ctcgagccagttgggcgtaatactgcgccagcgatcgctcttgctgcgttggccactgtc
aatagccaacctaatactagtcctattatgcttgtgctggcagcagatcatgttatccag
aatgaaaatgcgtttcgtgaggcggtgctcaaagcacttccgcttgctgaggaaggcaag
ttggtgacttttgggatagtacccaacaagccagaaacgggttacggctatatccgcagg
ggtgatcctagcggcgacagtgagccagtgaatgcttacaaggttgcacaatttgtggag
aaaccgaatcaggaaacagcagaatcctacgtatctagtggtgagtattactggaacagc
ggtatgttcctgttccgtgctgatcgttatctcgaagagctcaataaatatcgtcctgac
attcttgccgcatgtaagaaagccatgaatgtgacaaatcccgatcttaattttatacga
attgatcaagaggctttcatcacttgccctgatgaatctgttgattatgcagtcatggaa
aaaaccacggacgctgtggttgtgccattggatgctggatggagcgatgtgggttcctgg
tcctctctttgggatattagccgcaagacgcctgaaggaaatgtaaatactggggatgtg
ctgtcatgcaacacagaaaacagcttcctttattcagaatccgggctgttggctactgtt
ggtgtaaaagatttagtcgttgtgcaaactaaagatgcagtgttgattgccgatcgaaat
gctgttcaagacgttaaaaaaatagttgaaatgattaagtctgaagggcgtttagaacat
catgcgcatcgtgaagtttatcgtccctggggtaaatatgattctatagatactggcgag
cgctatcaggttaaacgtcttaccgtcaaacctggagaaggcatctcattacaaatgcac
catcatcgtgctgaacattggattgtggttgcgggtacggcacaagtcacgatcaacgat
caaagtaggctattaggtgaaaatgaatccatctatattccagttggagcaacacattgt
cttgagaaccctggaaaaatccctctggagctgatcgaggtgcgctcgggttcttatctg
ggagaagatgacattgttcggttagctgaccggtatggaagagtgtga

DBGET integrated database retrieval system