KEGG   Enterobacter sp. 638: Ent638_2915Help
Entry
Ent638_2915       CDS       T00507                                 

Definition
(GenBank) protein of unknown function DUF877
  KO
K11900  type VI secretion system protein ImpC
Organism
ent  Enterobacter sp. 638
Brite
KEGG Orthology (KO) [BR:ent00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ent02044]
    Ent638_2915
Secretion system [BR:ent02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Ent638_2915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VipB APG6
Motif
Other DBs
NCBI-ProteinID: ABP61579
UniProt: A4WCZ9
Position
complement(3160133..3161740)
Genome map
AA seq 535 aa AA seqDB search
MLWHRKKSDGRDVKRFNEEKMLMSVKNEYTTGSETVVLERSESGGVYASLFEKINLNPVS
ELSALDIWQDAQAMSDATSDERLTAGMQVFLECLSKAGSKVEKLDKNLIDHHIAELDYQI
SRQLDAVMHHDDFQAVESLWRGVKSLVDKTDFRQNVKIELLDLSKASLRQDFEDAPEIIQ
SGLYKHTYIDEYDTPGGEPIGALISAYEFDASAQDVALLRNISKVSAAAHMPFIGSAGPK
FFLKNSMEDVAAIKDIGNYFDRAEYIKWKSFRNTDDSRYIGLVMPRVLGRLPYGPDTVPV
RSFNYVEEVKGPEHDKYLWTNASFAFASNMVRSFINNGWCVQIRGPQAGGAVQDLPIHLY
DLGTGNQVKIPSEVMIPETREFEFANLGFIPLSFYKNRDYSCFFSANSTQKPALYDTADA
TANSRINARLPYIFLLSRIAHYLKLIQRENIGTTKDRRLLELELNTWVRGLVTEMTDPGD
ELQASHPLRDAKVVVEDIEDNPGFFRVKLFAVPHFQVEGIDVNLSLVSQMPKAKS
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
gtgctctggcaccgaaaaaagtctgacggtcgcgatgttaaacggtttaatgaagagaaa
atgctgatgtctgtaaaaaatgaatatacgactggtagtgaaaccgtcgtgctggaacgt
tctgaatcaggtggtgtatatgcatccctgtttgaaaaaatcaatctcaatccggtttct
gagctgagtgcgctggatatatggcaggatgcacaggccatgtctgatgcaacttctgat
gagcggttgaccgccggtatgcaggtgtttctggaatgccttagtaaagccggttcaaag
gtcgaaaaattagataaaaacctgattgaccatcatattgcggagcttgattaccaaatc
agtcgtcagctggatgcggtaatgcaccatgacgactttcaggctgtcgaatctctttgg
cgcggtgtgaaatcgctggtggataaaactgactttcgccagaacgtcaaaattgagctg
ctcgatctgtcgaaagcgtctttgcgacaggactttgaggacgcgccggaaattattcaa
agcgggctgtataaacatacctatattgatgagtacgacaccccaggcggagaacccatc
ggtgcgttgatttctgcgtatgaatttgatgcgtcagcacaggacgtggctctgctgcgt
aatatctccaaagtatctgccgcagcgcatatgccgtttatcggctctgccggcccgaaa
ttcttcctgaagaattcgatggaggatgtggccgccatcaaggatatcggtaactacttt
gaccgcgctgaatacatcaaatggaaatccttccgcaatactgatgattcccgttatatc
ggtttggtgatgccacgtgtactgggtcgtctgccgtatggccctgacaccgtgcctgtt
cgcagctttaactatgtcgaagaagtgaaaggcccggagcatgataaatatctctggacc
aatgcatcattcgcctttgcatccaatatggttcgtagcttcattaacaatggttggtgc
gtgcaaattcgtggcccgcaggctggtggtgccgtacaggatctgcctatacatctgtac
gatctgggtaccggcaatcaggtgaagatcccgtcagaagtgatgatcccggaaacccgt
gagtttgagtttgcgaacctgggctttattccactaagtttttataaaaatagagattat
tcctgcttcttcagcgctaactctactcagaagccggccctgtatgacaccgcggatgca
acggccaacagccgcattaatgcacgtctgccctatatcttcctgctgtcgcgtattgcg
cactatctgaaactgattcagcgcgaaaatattggtacgaccaaagaccgacgtcttctt
gaactggagctcaatacttgggttcgtggcctggtcaccgaaatgaccgatccgggcgat
gagttgcaagcctcgcaccccctgcgtgatgcgaaagtggtggtggaagatatcgaggac
aatcctggtttcttccgcgtgaaactgtttgccgtgccgcacttccaggtggaaggcata
gacgtcaacctgtcactggtttcccagatgccgaaagccaaatcctag

DBGET integrated database retrieval system