KEGG   Enterobacter sp. 638: Ent638_2916
Entry
Ent638_2916       CDS       T00507                                 

Definition
(GenBank) uncharacterised conserved protein UCP028301
  KO
K11901  type VI secretion system protein ImpB
Organism
ent  Enterobacter sp. 638
Brite
KEGG Orthology (KO) [BR:ent00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ent02044]
    Ent638_2916
Secretion system [BR:ent02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Ent638_2916
SSDB
Motif
Pfam: T6SS_VipA GerD
Other DBs
NCBI-ProteinID: ABP61580
UniProt: A4WD00
Position
complement(3161715..3162212)
AA seq 165 aa
MSNSYQSEIPKARVNIQLSLHTGGAQKKVELPLKLVLVGDYSNGTEQRPVSEREKVNVNK
NNFDSVLAEFSPAIKLSVENTLAHDGSEEAINLTFRDMKDFTPEQVARQIPQLKAMLAMR
NLLRDLKANLLDNQAFRKELEKILVDPQLSSELRSELSALAPKKV
NT seq 498 nt   +upstreamnt  +downstreamnt
atgtctaattcctatcaatccgagatccctaaggctcgcgtcaatatccagttaagtttg
catacaggtggcgcacagaaaaaagtcgaattacccctaaaacttgttttggtgggtgat
tacagcaacggaacagagcagcgtcccgtgtcggagcgcgaaaaggtcaatgtaaataaa
aataactttgacagcgtgcttgctgagttttcgccagccataaagctttcagttgaaaac
acgcttgcacatgacggcagtgaagaagccataaatctcaccttccgcgacatgaaagac
ttcacaccggaacaggtcgctcgtcagatccctcaactgaaagccatgcttgccatgcgt
aatcttctccgagacctcaaagccaatctgctcgataaccaggctttccgtaaagagctg
gaaaaaattctggtagacccacaactcagcagtgagctgcgcagtgagttgagtgctctg
gcaccgaaaaaagtctga

DBGET integrated database retrieval system