KEGG   Enterobacter sp. 638: Ent638_3299Help
Entry
Ent638_3299       CDS       T00507                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ent  Enterobacter sp. 638
Pathway
ent00071  Fatty acid degradation
ent00280  Valine, leucine and isoleucine degradation
ent00310  Lysine degradation
ent00362  Benzoate degradation
ent00380  Tryptophan metabolism
ent00620  Pyruvate metabolism
ent00630  Glyoxylate and dicarboxylate metabolism
ent00640  Propanoate metabolism
ent00650  Butanoate metabolism
ent00900  Terpenoid backbone biosynthesis
ent01100  Metabolic pathways
ent01110  Biosynthesis of secondary metabolites
ent01120  Microbial metabolism in diverse environments
ent01130  Biosynthesis of antibiotics
ent01200  Carbon metabolism
ent01212  Fatty acid metabolism
ent02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ent00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Ent638_3299
   00630 Glyoxylate and dicarboxylate metabolism
    Ent638_3299
   00640 Propanoate metabolism
    Ent638_3299
   00650 Butanoate metabolism
    Ent638_3299
  Lipid metabolism
   00071 Fatty acid degradation
    Ent638_3299
   00072 Synthesis and degradation of ketone bodies
    Ent638_3299
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Ent638_3299
   00310 Lysine degradation
    Ent638_3299
   00380 Tryptophan metabolism
    Ent638_3299
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Ent638_3299
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Ent638_3299
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Ent638_3299
Enzymes [BR:ent01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Ent638_3299
Exosome [BR:ent04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Ent638_3299
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III DUF3103
Motif
Other DBs
NCBI-ProteinID: ABP61963
UniProt: A4WE33
Position
complement(3604643..3605821)
Genome map
AA seq 392 aa AA seqDB search
MKDVVIVGALRTAIGCFQGALARHSAVDLGSVVLKALVERSGIAAHEIDEVILGQVLTAG
AGQNPARQAALKGGLPNTVSAITINDVCGSGLKALHLATQAIQCGEADVIIAGGQENMSR
APHVLTDSRTGAQLGNSQLLDSLVHDGLWDAFNDYHMGVTAENLAREYGISRELQDDYAL
NSQHKARAAIDSGRFRDEIVPVKTVRQNGEPLIVDTDEQPRTDASAEGLAKLNPAFETLG
SVTAGNASSINDGAAAVMMMSESKAEELNLPVLARIKAFASVGVDPALMGIAPVYATRRC
LERAGWQLGDVDLIEVNEAFAAQALSVGKMLEWDPRRVNVNGGAIALGHPIGASGCRILV
SLVHEMIKRDARKGLATLCIGGGQGVALAIER
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgtcgtgatagtgggtgcgttacgtacggctatcggctgttttcagggggcg
ctggcacggcattctgcggtggatctgggcagtgtggtgcttaaagctctggtagagcgc
agtggaattgccgcacatgaaatcgacgaagtgattttgggccaggtgctgacggcaggc
gccgggcaaaatcctgcgcgtcaggccgcactcaaaggtgggttacccaacacggtgtcg
gccattacgattaacgatgtttgcggatcgggtctaaaagcgctgcatctggcgacacag
gcgattcagtgcggtgaagcagatgtcatcattgcaggcggccaggaaaacatgagccgt
gccccgcacgttctcaccgacagccgtaccggcgcgcagctcggcaacagtcagcttctg
gacagcctggtgcacgatggtttatgggacgctttcaatgattatcacatgggcgtaacg
gccgaaaacctggcccgcgaatacggcatcagccgtgaattacaggatgattacgcgctc
aattcgcagcacaaagcgcgcgccgcaatcgactccggtcgctttcgtgatgaaattgtc
ccggtaaaaaccgtgcgacaaaatggcgaaccgctgattgtagacaccgacgaacaaccg
cgcacggatgccagcgcagaagggctggcgaaactgaatcctgcgtttgagacgctgggc
tcggtgacggcgggaaacgcctcttctattaacgacggcgcagctgccgtgatgatgatg
agcgaaagcaaagcggaagagctgaatctgccggtgctggctcgtatcaaagcctttgcc
agcgtcggggtcgatccggctctgatgggcatcgcgccggtttacgccacgcgtcgttgt
ctggaacgtgcgggctggcagcttggcgatgtcgatctgattgaagtcaacgaggcgttt
gccgctcaggcgttatccgtggggaaaatgctggagtgggatcctcgccgtgtgaacgtc
aacggcggggcgattgccctcggccacccaattggtgcctccggatgccgtattttagtt
tcactggttcatgaaatgatcaagcgcgatgcacggaaaggtctggcgacgctgtgtatt
ggcggcggtcagggtgtggcattagccatcgaaagataa

DBGET integrated database retrieval system