KEGG   Enterobacter sp. 638: Ent638_3746Help
Entry
Ent638_3746       CDS       T00507                                 

Definition
(GenBank) LSU ribosomal protein L22P
  KO
K02890  large subunit ribosomal protein L22
Organism
ent  Enterobacter sp. 638
Pathway
ent03010  Ribosome
Brite
KEGG Orthology (KO) [BR:ent00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Ent638_3746
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ent03011]
    Ent638_3746
Ribosome [BR:ent03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    Ent638_3746
  Bacteria
    Ent638_3746
  Archaea
    Ent638_3746
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ABP62403
UniProt: A4WFC3
Position
complement(4050044..4050376)
Genome map
AA seq 110 aa AA seqDB search
METLAQHRHARSSAQKVRLVADLIRGKKVSQALDILTYTNKKAAVFVKKVLESAIANAEH
NDGADIDDLKVAKIFVDEGPSMKRIMPRAKGRADRILKRTSHITVVVSDR
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaaactttagctcaacatcgccatgctcgttcttctgctcagaaggttcgccttgtt
gctgacctgattcgcggtaagaaagtgtcgcaggccctggacatcctgacttataccaac
aagaaagctgcggtattcgtcaagaaagtactggaatctgccattgctaacgctgaacac
aacgatggcgctgacattgacgatctgaaagttgcgaaaattttcgtagatgaaggccca
agcatgaagcgcattatgccgcgtgcgaaaggtcgtgcagatcgcatcctgaagcgcacc
agccacattactgtggttgtgtccgatcgctga

DBGET integrated database retrieval system