KEGG   Enterobacter sp. 638: Ent638_4248
Entry
Ent638_4248       CDS       T00507                                 

Definition
(GenBank) GnsAGnsB family protein
Organism
ent  Enterobacter sp. 638
SSDB
Motif
Pfam: GnsAB_toxin
Other DBs
NCBI-ProteinID: ABP62853
UniProt: A4WGM3
Position
pENTE01:complement(74970..75146)
AA seq 58 aa
MMDNDELVRKAEEEIAALIVKKTVELRKKTGKELSSIEFIPKETMAGLEGYQIKINLL
NT seq 177 nt   +upstreamnt  +downstreamnt
atgatggataatgatgaacttgtaagaaaagccgaagaggaaattgcagcgctcattgtg
aaaaaaacagtggagttacgaaaaaagacaggaaaagaactttcctcaattgaatttatc
ccaaaggaaacgatggccggtcttgaaggttatcagattaaaataaaccttctctag

DBGET integrated database retrieval system