KEGG   Enterobacter sp. 638: Ent638_4287
Entry
Ent638_4287       CDS       T00507                                 

Definition
(GenBank) TraB pilus assembly family protein
  KO
K12065  conjugal transfer pilus assembly protein TraB
Organism
ent  Enterobacter sp. 638
Brite
KEGG Orthology (KO) [BR:ent00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ent02044]
    Ent638_4287
Secretion system [BR:ent02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Ent638_4287
SSDB
Motif
Pfam: TrbI DUF4407
Other DBs
NCBI-ProteinID: ABP62892
UniProt: A4WGS4
Position
pENTE01:110850..112250
AA seq 466 aa
MSLNENLKTRRTQLAVLATVIAVGAATAGGVMWYGNHQEQQKHPAPVAAPNMTGVVTASF
NEQVNDAALAQQQAKTSALEQQYATLAQLVAQNKLTTEQKLAEKDAEIQRLTDQVQKAPG
SNTTTGQQSPPAGQNGTPLPGPVAAGQARPPEYSVTPNAPAATGVNMGQGAGFYPGGSGQ
RLTGGLSTTKFSYDSLKKKPTKLPWIPSGSFSDAVMIEGADANASVTGQQNTSPVTLRLQ
GNIQMPNNKEYSADGCFIVGEIWGDISSERGTVRTQSISCVLKNGKHVDMEFQGHVSYQG
KNGIRGKPVMRNGMIVGYAGAAGMLSGFGEGIKSAATPSVGLGATADVGAGDVFKQGFGG
GANKAADTLSQYWIKRAEQYHPVIDIGAGNQVTVVFQKGFRLETLEDAEDAKAKEELQKA
GNAAQNAVSPQPASQSTTSGTASVGNINPDDVLRQASQLRLGDTIN
NT seq 1401 nt   +upstreamnt  +downstreamnt
atgagtctgaacgaaaatcttaaaacccgccgcacccagttggctgttctggccaccgtg
attgccgtcggtgccgccaccgccggcggcgtgatgtggtacgggaatcatcaggaacag
caaaagcaccctgcgcctgttgccgcacccaatatgaccggcgtggtcaccgcctccttt
aatgagcaggtgaacgacgcggcactggcacagcagcaggccaaaacctctgcgcttgag
cagcagtacgccacgcttgctcagctggtcgcccagaacaagctcaccacagaacagaaa
ctggccgagaaggacgctgaaattcagcgcctgaccgaccaggtccagaaagcccccggc
agcaacacgaccacgggccagcagtcaccacctgctggccagaacggaacaccactcccg
ggtcccgttgctgccggtcaggcccgaccgccggaatactccgtcacccccaacgcaccg
gccgccactggtgtcaacatggggcagggcgcagggttctatccgggcggctcaggccag
cgattaaccggtggactctccaccacgaagttcagttatgacagcctaaaaaagaagccc
actaagctgccgtggataccgtccggctctttctctgacgccgtcatgattgaaggggct
gatgccaatgccagcgtcaccggtcagcaaaacaccagtcccgtaacgcttcgcctgcag
ggcaatattcagatgcccaacaacaaggaatacagcgccgacggatgtttcatcgtaggg
gaaatctggggtgacatttccagtgagcgcggcaccgtgcgcacccagtccatcagctgc
gtgctgaagaacggcaaacacgtcgatatggagtttcaggggcacgtcagctaccagggc
aaaaacgggattcgcggcaagcctgtcatgcgtaacggcatgattgtcggctacgccggc
gcggccggtatgctgtctggttttggtgagggcatcaagtccgccgccacaccgtccgtg
ggtctcggtgcaacagccgatgttggcgcaggtgacgtattcaaacagggcttcgggggc
ggtgccaataaagcggctgacacgctgagccagtactggatcaagcgcgccgagcagtat
cacccggtgattgatatcggggccggcaaccaggtcacggtggtattccagaagggcttc
cgccttgaaacactggaagatgctgaggacgcgaaggcgaaagaggagttgcagaaagcc
ggcaatgccgcgcagaacgctgtctcgccacaacctgccagtcagtcgaccacctccggc
acggcgtcagtcggcaatatcaatcccgatgatgtgcttcgtcaggccagccagctgcgc
ctcggtgacactatcaactga

DBGET integrated database retrieval system