KEGG   Enterobacter sp. E20: NI40_003325Help
Entry
NI40_003325       CDS       T04118                                 

Gene name
apaG
Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
enx  Enterobacter sp. E20
Brite
KEGG Orthology (KO) [BR:enx00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    NI40_003325 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: ALL16216
Position
complement(704296..704673)
Genome map
AA seq 125 aa AA seqDB search
MIDSPRVCVHVQSVYVESQSSPDEERFVFAYTVTIRNLGRMPVQLRGRYWLITNGNGREI
EVQGEGVVGEQPHIAPGEEYQYTSGAVIETPMGTMQGHYEMVDVDGNDFRVAIPVFRLAV
TTLIH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgattgattcgccccgcgtatgtgtccatgtacaaagcgtctatgttgaatcacagtcc
tcaccggacgaagaacgttttgttttcgcttacaccgtgaccattcgcaatctggggcgg
atgcccgtgcagctgcgcgggcgctactggcttatcactaacggcaatggccgcgaaatc
gaagttcagggcgaaggtgtggtcggtgaacagccccacatcgcccctggcgaagagtat
cagtacaccagcggcgcggtgattgaaacgccgatgggtaccatgcagggccattatgaa
atggtcgacgtcgatggcaatgatttccgcgttgccattcctgtgttccgtctcgccgta
accacactcattcattaa

DBGET integrated database retrieval system