KEGG   Enterobacter sp. E20: NI40_003505Help
Entry
NI40_003505       CDS       T04118                                 

Gene name
murD
Definition
(GenBank) UDP-N-acetylmuramoylalanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
enx  Enterobacter sp. E20
Pathway
enx00471  D-Glutamine and D-glutamate metabolism
enx00550  Peptidoglycan biosynthesis
enx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:enx00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    NI40_003505 (murD)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    NI40_003505 (murD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:enx01011]
    NI40_003505 (murD)
Enzymes [BR:enx01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     NI40_003505 (murD)
Peptidoglycan biosynthesis and degradation proteins [BR:enx01011]
 Precursor biosynthesis
  Amino acid ligase
   NI40_003505 (murD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: ALL16252
Position
750139..751455
Genome map
AA seq 438 aa AA seqDB search
MADYQGKKVVIIGLGLTGLSCVDFFLARGVTPRVMDTRVSPPGLDKLPEQVERHLGGLND
DWLLAADLIVASPGMALAHPSLSAAADAGVEIVGDIELFCREAQAPIIAITGSNGKSTVT
TLVGEMAKAAGMNVGVGGNIGLPALMLLDKGCELYVLELSSFQLETTSSLHAAAATILNV
TEDHMDRYPFGLQQYRAAKLRVYENAKVCVVNADDALTMPVRGADDRCISFGITMGDYHL
NRQLGETWLRVKGEKVLNVKEMKLTGQHNYTNALAALALADAVGLPRSSSLKALTTFSGL
AHRFQLALEHNGVRWINDSKATNVGSTEAALNGLHVDGTLHLLLGGDGKSADFSSLKPYL
AGDNVRLYCFGRDGSELAELRPEVAEQTETMEQAMRLIAPRVKPGDMVLLSPACASLDQF
KNFEQRGDVFTRLAKELG
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atggcagattaccagggcaaaaaagtcgttatcatcgggttgggcctcacggggctctcc
tgcgtggactttttcctcgcacgcggcgtgacgccacgcgtgatggatacgcgtgtctct
ccgccgggtctggacaaactgccggaacaggttgaacgccaccttggtggtctgaatgat
gactggctgctggcagccgatctgattgtcgccagcccgggtatggcgctggcgcatcct
tcgctgagcgctgctgcggatgcgggcgttgagattgtcggcgatatcgagctgttctgc
cgcgaagcgcaggcacctattatcgccattaccggttctaacggtaaaagcaccgtcacc
accctggtgggtgaaatggcgaaagcggcgggcatgaacgtcggcgttggcggtaacatt
ggtttacccgctctgatgctgctggataaaggctgcgagctgtatgttctcgagctttcc
agcttccagctggaaacgacctccagcctgcacgctgcggcggcgacgatcctcaacgtg
actgaagatcatatggatcggtatccatttggtctgcagcagtaccgcgccgccaagctg
cgcgtttatgaaaatgccaaagtctgcgttgtaaacgccgatgacgcgctgaccatgccc
gtacgcggtgcagacgatcgctgtatcagcttcggtatcacgatgggggattaccacctg
aaccgtcagctgggcgaaacctggctgcgcgtgaagggtgagaaagtgctgaacgtgaaa
gagatgaagctcactggtcagcacaactataccaatgccctggcggcgctggcgctggcg
gatgcagtagggctgccgcgctcctccagcctgaaagcgttaaccacgttttctggtctg
gcgcaccgtttccagctggcgctggagcacaacggcgtgcgctggattaacgactccaaa
gctaccaacgtcggaagcacggaggccgcgctgaacggtctgcacgttgacggcaccctg
catttactgctgggcggcgacggtaaatcagctgatttttcctccctgaagccgtatctc
gccggagataacgtccgcctgtactgcttcggccgtgacggcagcgagctggctgaactg
cgccctgaggttgccgagcaaaccgaaaccatggaacaggcgatgcggctgattgcccct
cgcgtgaagccaggcgatatggtgctgctctctccggcctgtgccagcctcgatcaattc
aagaatttcgaacagcgtggtgatgtctttacccgcctggcgaaggagttaggctaa

DBGET integrated database retrieval system