KEGG   Enterobacter sp. E20: NI40_007445Help
Entry
NI40_007445       CDS       T04118                                 

Definition
(GenBank) cytochrome C
  KO
K14188  D-alanine--poly(phosphoribitol) ligase subunit 2 [EC:6.1.1.13]
Organism
enx  Enterobacter sp. E20
Pathway
enx00473  D-Alanine metabolism
enx01100  Metabolic pathways
enx01503  Cationic antimicrobial peptide (CAMP) resistance
enx02020  Two-component system
Brite
KEGG Orthology (KO) [BR:enx00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    NI40_007445
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    NI40_007445
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    NI40_007445
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:enx01504]
    NI40_007445
Enzymes [BR:enx01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.13  D-alanine---poly(phosphoribitol) ligase
     NI40_007445
Antimicrobial resistance genes [BR:enx01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, dltABCD operon [MD:M00725]
    NI40_007445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PP-binding
Motif
Other DBs
NCBI-ProteinID: ALL16998
Position
complement(1611281..1611499)
Genome map
AA seq 72 aa AA seqDB search
MEQEILALFEKVLSRKVGFHDELIESDILDSILAVDMVLEVQDVYGCMIPPTDVATVLKT
PADLARYIEENR
NT seq 219 nt NT seq  +upstreamnt  +downstreamnt
atggaacaagaaattctcgccctgttcgaaaaagtgttatcccgtaaggtgggctttcac
gatgaactgattgaatccgacattctcgactccatcctggcggtcgatatggtgctggaa
gtgcaggacgtttacggctgcatgatcccgccaactgacgtggcgacggtgctaaaaacc
ccggcggacctggcccgctatattgaagaaaaccgctaa

DBGET integrated database retrieval system