KEGG   Enterobacter sp. E20: NI40_007535Help
Entry
NI40_007535       CDS       T04118                                 

Definition
(GenBank) gamma-glutamyltransferase
  KO
K22602  oxamate amidohydrolase [EC:3.5.1.126]
Organism
enx  Enterobacter sp. E20
Pathway
enx00230  Purine metabolism
enx01100  Metabolic pathways
enx01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:enx00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    NI40_007535
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:enx01002]
    NI40_007535
Enzymes [BR:enx01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.126  oxamate amidohydrolase
     NI40_007535
Peptidases and inhibitors [BR:enx01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   NI40_007535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: ALL17014
Position
complement(1627425..1629008)
Genome map
AA seq 527 aa AA seqDB search
MQSNVSTHGMAVAPHHLASQSALAVLREGGSAIEAMVAAAATVAVVYPHMNGLGGDGFWL
IVPPEGEPVAIDASGAAGSRATLAAYDGLAHIPHRGPRAALTVAGTVSGWDEALKVSREL
TGKALPLSRLLADAIDYAQNGTPVTASQAHATASKFDELKDVPGFAETWLVDGKPPQVGS
RFYQPAMATTLTRLAEDGLDSFYRGPLADVMAHGMETLGLPVTLADLNAHAARRTAPLTL
QHQQGVIFNHAPPTQGLVSLAILGITDRLNMAEADDADTIHRIVEATKLAFGLRDAHITD
PRELKTDIQGLLDPAALQALADRVDDGRAAPWGTGKGPGDTVWMGVMDNSGLAVSFIQSI
YHEFGSGVVLPDTGIVWQNRGASFSLDPNHLLALAPGKQPFHTLNPAAARLKDGRVMVYG
SMGGDGQPQTQAALFTRYAIQGVPLQESISRPRWLLGRTWGQTSDTLKLEGRFTAETVSR
LQALGHEVEMFPDFSEAMGHAGAIVRHLNGLFEGAFDPRSNGAAAGF
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagtaatgtctccacgcacggcatggccgttgcgccccaccatcttgccagccag
agcgcgctggcggtactgcgcgaaggcggcagcgcgatagaggcgatggtcgccgcggcg
gccaccgttgccgtggtttatccgcacatgaacgggctgggcggcgatggcttctggctt
atcgtgccgccggaaggcgaacctgtcgccattgatgccagcggcgcggcgggatcgcgc
gcgacgctcgccgcctacgacggtctggcgcatatcccccatcgcggcccccgcgcggcg
ctgaccgtcgccggcacggtgagcggctgggacgaggcgctgaaggtctcgcgcgagttg
accggcaaggcgctgccgctgtcccgactgctggccgacgccattgactatgcgcagaac
ggcacgccggtcacggcctctcaggcccacgccacggccagcaaattcgacgagctgaag
gacgtccccggcttcgcggaaacctggctggtggacggtaagccgccgcaggtcgggagc
cgcttttaccagcccgccatggccacgacgttgacgcgcctggcggaagacggtctggac
agcttttaccgcggcccgctggcggacgtgatggcgcacggcatggagacgctgggcctg
cccgtgacgctggccgatcttaacgcgcacgctgcccggcgaaccgcgccgctgacgctg
cagcatcagcagggggtgatctttaaccatgccccgccgacgcaggggctggtctcgctg
gcgatactcggcatcaccgaccgcctgaacatggccgaggccgacgacgccgataccatt
caccgcatcgttgaagccaccaagctggcctttggcctgcgcgatgcccacatcaccgac
ccgcgcgagctgaaaaccgatattcagggtctgctggatcccgccgccctgcaggcgctt
gccgacagggttgacgacggccgcgccgcgccgtgggggaccggaaaaggccccggcgat
acggtgtggatgggagtgatggataacagcgggcttgccgtgtcgtttatccagagtatc
tatcacgagttcggcagcggcgtggtgctgcccgacaccggcatcgtctggcagaaccgg
ggcgcatcgttcagcctcgatcccaatcatcttctggccctcgcgccgggcaaacagccc
ttccataccctgaacccggcggcggcgcgccttaaggacgggcgcgtgatggtctacgga
tcgatgggcggtgacggacagccgcaaacccaggccgcgctttttacccgctacgcgatt
cagggcgtgcctttacaggagagcatttcccgcccgcgctggctgctggggcgcacctgg
ggacaaacctcggacacgttaaagctggaaggacgctttaccgctgagacggtctcacgg
cttcaggcactcgggcacgaggtggaaatgttccctgacttcagcgaagcgatgggccac
gcgggcgcgattgtccgccacctcaacgggctgttcgaaggggcatttgacccgcgcagc
aacggcgcggccgccggattctga

DBGET integrated database retrieval system