KEGG   Enterobacter sp. E20: NI40_011320Help
Entry
NI40_011320       CDS       T04118                                 

Definition
(GenBank) histidine kinase
  KO
K07644  two-component system, OmpR family, heavy metal sensor histidine kinase CusS [EC:2.7.13.3]
Organism
enx  Enterobacter sp. E20
Pathway
enx02020  Two-component system
Brite
KEGG Orthology (KO) [BR:enx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    NI40_011320
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:enx01001]
    NI40_011320
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:enx02022]
    NI40_011320
   01504 Antimicrobial resistance genes [BR:enx01504]
    NI40_011320
Enzymes [BR:enx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     NI40_011320
Protein kinases [BR:enx01001]
 Histidine kinases
  OmpR family
   NI40_011320
Two-component system [BR:enx02022]
 OmpR family
  CusS-CusR (copper tolerance)
   NI40_011320
Antimicrobial resistance genes [BR:enx01504]
 Gene sets
  beta-Lactam resistance modules
   Imipenem resistance, repression of porin OprD [MD:M00745]
    NI40_011320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA HATPase_c_5 HAMP HATPase_c_2 DUF3139 Arylsulfotrans
Motif
Other DBs
NCBI-ProteinID: ALL17724
Position
2398138..2399592
Genome map
AA seq 484 aa AA seqDB search
MRVKLPGRPFSLALRLTFFISLSTILAFFAFTWFMLHSVEKHFAEQDVSDLQQISTAMHR
ILQSPVDPDQKKISKIKESIASYRNVAVLLLDPQGNILFSSAQGAALRPAMNAADFSEHR
RAQDVFLWTVEDPAANMHAGSDMKMETYRIIASSGTATLQGKTQGYVMLIGLSINFHLHY
LEALKKNLLAIAAAISLLIILVIRIAVRQGHLPLRNVSNAIKNITSENLDARLEPSRVPV
ELEQLVISFNHMIEKIEDVFTRQANFSADIAHEIRTPITNLVTQTEIALSQNRSQKELED
VLYSSLEEYNRMTRMVSDMLFLAQADNNQLVPDRVVFDLSAEVMKVFDFFEAWAEERNVT
LKFNGMPCLIEGDPQMFRRAVNNLLSNALRYTPAGKAVTVSIREQDNDVELMIENPGTPI
PQEHLPKLFDRFYRVDPSRQRKGEGSGIGLSIVKSIVSAHHGKVRVESDAVSTRFILIVP
GKVA
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgttaagcttcccgggcgccctttttcgcttgccctgcggctgaccttttttatc
agtctctccacgatactggcctttttcgcctttacctggtttatgctgcattccgttgaa
aagcacttcgccgagcaggatgtcagcgacctgcagcaaatcagcaccgcgatgcaccgc
atcctgcagtctccggtcgatcctgaccaaaagaaaatcagtaaaatcaaagagtctatc
gccagctaccgcaacgtggccgtcctgctcctggatccgcagggcaatatcctgttcagc
tcggcgcaaggggcagcactgcgccctgcgatgaacgcggcggacttcagcgaacaccgc
cgcgcgcaggatgtgtttctctggacggttgaagaccctgccgcaaacatgcacgccggg
tccgacatgaaaatggaaacgtaccggattatcgcctcttcaggcacggcgacgctgcag
ggcaaaacgcagggctacgtgatgctgatcgggctctccatcaattttcatctgcactac
cttgaggcgctgaaaaagaatctcctggcgattgccgcggcgatcagcctgctgattatt
cttgtcattcgcatcgcggttcgtcagggacatttgcccctgcgtaacgtcagcaacgcc
attaaaaatatcacttcagaaaacctcgacgcgcggctggagccgtcccgcgtgcccgtt
gagctggaacagctggtcatctccttcaaccatatgatcgaaaagattgaagatgtcttt
acccgtcaggcgaatttttccgccgatatcgcgcatgaaatcagaacccccatcaccaac
ctggtgacgcaaacggaaatcgcgctgagccagaatcgctcgcagaaagagctggaggat
gttctgtactccagccttgaagagtacaaccggatgacccgcatggtcagcgacatgctt
ttcctggcgcaggcggataataaccagctcgtccctgaccgggtggtgtttgatttaagt
gcggaggtcatgaaagtcttcgatttcttcgaagcctgggcggaagaacgcaacgttacg
ctgaaatttaacgggatgccctgcctgatagaaggcgatccgcagatgttcagaagagca
gtaaataatctgctctccaatgccctgcgctatacgccagccgggaaagcggtgacggtc
tccatcagagaacaggataacgacgttgaactgatgatagaaaatcccggtacgccgatc
ccgcaagagcatctgccaaagctgtttgaccgtttctatcgcgtcgatccgtcaaggcag
cgcaaaggcgaaggcagcgggatcgggctttccatcgtgaagtccatcgtctccgcgcat
cacgggaaagtccgggtggaatcggatgcggtatcgacgcgcttcatcctcatcgtgccg
ggaaaagtggcctga

DBGET integrated database retrieval system