KEGG   Enterobacter sp. E20: NI40_013460Help
Entry
NI40_013460       CDS       T04118                                 

Gene name
rrmA
Definition
(GenBank) 23S rRNA methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
enx  Enterobacter sp. E20
Brite
KEGG Orthology (KO) [BR:enx00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:enx03009]
    NI40_013460 (rrmA)
Enzymes [BR:enx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     NI40_013460 (rrmA)
Ribosome biogenesis [BR:enx03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    NI40_013460 (rrmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_31 Methyltransf_11 Methyltransf_25 Ubie_methyltran Methyltransf_23 Methyltransf_12 Methyltransf_29 PCMT Methyltransf_32 MTS Methyltransf_9 MetW
Motif
Other DBs
NCBI-ProteinID: ALL18128
Position
complement(2884081..2884896)
Genome map
AA seq 271 aa AA seqDB search
MSFSCPLCHAPLTHSDKSYTCPQGHQFDMAKEGYVNLLPVQHKRSRDPGDSAEMMQARRA
FLDAGHYLPLRETVAQMLNDILPGSATAMLDIGCGEGYYTARFAGIAREKGALTFGLDVS
KVAIRAAAKRYADVTFCVASSHRLPFDDASMDAVIRIYAPCKAEELSRVVKPGGWVVTVT
PGPRHLMELKGLIYDEVRLHAPHSEQLSGFTLKQEQTVAYEMTLKGEEATALLQMTPFAW
RAKPEVWEALAVQSIFNCQTDFSIHVWQRED
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgtccttcagctgtcctctttgccacgcccccctgacgcattcagataaaagctatacc
tgtccgcaggggcatcagtttgatatggcaaaagaaggctacgtgaatcttctgccggtg
cagcataagcgctcccgcgatccaggcgacagtgcagagatgatgcaggcgcgtcgtgcg
tttctggatgccgggcactatctgccgctgcgggaaaccgtcgcgcagatgctgaatgac
atcctgccgggttcagccaccgctatgctcgatatcggctgcggggaagggtactacacc
gcacggtttgccgggatcgcacgcgagaagggcgcgttgacattcggtctggacgtgtcg
aaagtggccattcgcgcggcggcaaagcgttacgcggacgtgacgttctgcgtggcatcc
agccaccggctgccgtttgacgatgccagcatggatgcggttatccgcatttacgcgccc
tgcaaggcggaagagctgtctcgcgtggtgaaaccgggcggatgggtagtcaccgtaacg
ccgggcccgcgtcatctgatggagctgaaagggctgatctacgacgaagtgcgtctgcat
gcacctcattctgaacagctgtccggttttacccttaagcaggagcaaaccgtggcgtat
gaaatgacgctgaaaggcgaagaggccaccgcgctgctgcagatgacgccgttcgcatgg
cgggcaaaaccagaagtatgggaagcgttagctgtacaatcaatatttaactgccagacg
gatttcagtatccacgtctggcagcgcgaagattaa

DBGET integrated database retrieval system