KEGG   Enterobacter sp. E20: NI40_018000Help
Entry
NI40_018000       CDS       T04118                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
enx  Enterobacter sp. E20
Pathway
enx00071  Fatty acid degradation
enx00072  Synthesis and degradation of ketone bodies
enx00280  Valine, leucine and isoleucine degradation
enx00310  Lysine degradation
enx00362  Benzoate degradation
enx00380  Tryptophan metabolism
enx00620  Pyruvate metabolism
enx00630  Glyoxylate and dicarboxylate metabolism
enx00640  Propanoate metabolism
enx00650  Butanoate metabolism
enx00900  Terpenoid backbone biosynthesis
enx01100  Metabolic pathways
enx01110  Biosynthesis of secondary metabolites
enx01120  Microbial metabolism in diverse environments
enx01130  Biosynthesis of antibiotics
enx01200  Carbon metabolism
enx01212  Fatty acid metabolism
enx02020  Two-component system
Brite
KEGG Orthology (KO) [BR:enx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NI40_018000
   00630 Glyoxylate and dicarboxylate metabolism
    NI40_018000
   00640 Propanoate metabolism
    NI40_018000
   00650 Butanoate metabolism
    NI40_018000
  09103 Lipid metabolism
   00071 Fatty acid degradation
    NI40_018000
   00072 Synthesis and degradation of ketone bodies
    NI40_018000
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NI40_018000
   00310 Lysine degradation
    NI40_018000
   00380 Tryptophan metabolism
    NI40_018000
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NI40_018000
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    NI40_018000
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    NI40_018000
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:enx04147]
    NI40_018000
Enzymes [BR:enx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     NI40_018000
Exosome [BR:enx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NI40_018000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ALL18968
Position
complement(3873594..3874772)
Genome map
AA seq 392 aa AA seqDB search
MKDVVIVGALRTAIGCFQGALARHSAVDLGSVVVKALVERSGIAAYEVDEVILGQVLTAG
AGQNPARQAALKGGLPNTVSAITINDVCGSGLKALHLATQAIQCGEADVIIAGGQENMSR
APHVLTDSRTGAQLGNSQLLDSLVHDGLWDAFNDYHMGVTAENLAREYGISREVQDAYAL
SSQQKARAAIDSGRFRDEIVPVSTQRQSGERILVDTDEQPRTDASAEGLARLNPAFEMQG
SVTAGNASSINDGAAAVMMMSESKALELDLPVLARIKAFASVGVDPALMGIAPVYATRRC
LERAGWQLSDVDLIEVNEAYAAQAISVGKMLEWDPLRVNVNGGAIALGHPIGASGCRILV
SLVHEMKKRNARKGIATLCIGGGQGVALAIER
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgtcgtaatagtgggtgcgttgcgtacagctatcggctgttttcagggagcg
ctcgcgcgtcactcggcggttgacctgggcagcgtggtggtaaaagcgctggtggaacgc
agcgggatcgcagcatatgaagttgatgaggtgatcctgggacaggtcctcacggccggt
gccgggcaaaaccctgcgcgtcaggcggcgctgaagggcgggctgcccaataccgtttcg
gccatcaccatcaacgacgtctgtggttcaggattaaaagcgctgcatctcgcgacgcaa
gccattcagtgtggtgaagcggacgtgatcatcgcgggcgggcaggagaatatgagccgc
gcgccgcacgtgttgaccgacagccggaccggcgcacagcttggcaacagtcagctgctc
gacagcctggtgcatgacgggctttgggatgcgttcaatgactatcatatgggcgtgacg
gcggaaaacctggcgcgcgagtacggcatcagccgtgaggtgcaggatgcctatgcgcta
agctcgcagcaaaaagcgcgtgcggcgattgattccggtcgctttcgcgacgagattgtc
ccggtcagcacgcagcgtcagagcggcgagcgtatcctcgtggataccgatgaacagccg
cgcaccgacgccagcgctgaaggcctggcgaggctgaatcccgcgtttgaaatgcagggc
tcggtgacggcgggaaatgcctcttccattaacgacggcgctgctgccgttatgatgatg
agcgaaagcaaagcccttgaactcgatcttcccgtcctggcccgcattaaggcgttcgcc
agcgtaggggttgatcctgcgttaatggggatcgcaccggtctacgcgacacgccgctgc
ctggagcgcgcggggtggcagctttcggatgtggatctgatcgaggtgaacgaagcctat
gccgcgcaggcgatctccgtcggaaaaatgctggagtgggatcctctgcgggtcaacgtt
aacggtggcgcgatcgcgctgggccatcctatcggtgcgtccggctgccggatcctggtt
tcgctggtccacgaaatgaaaaagcgcaatgcccgcaaagggattgccacactctgtata
ggcggcgggcaaggggtggcgctggctatcgaacgctaa

DBGET integrated database retrieval system