KEGG   Escherichia coli O7 K1 CE10: CE10_0319Help
Entry
CE10_0319         CDS       T01999                                 

Gene name
mhpF
Definition
(GenBank) acetaldehyde-CoA dehydrogenase II, NAD-binding protein
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
eoc  Escherichia coli O7:K1 CE10
Pathway
eoc00360  Phenylalanine metabolism
eoc00362  Benzoate degradation
eoc00620  Pyruvate metabolism
eoc00621  Dioxin degradation
eoc00622  Xylene degradation
eoc00650  Butanoate metabolism
eoc01100  Metabolic pathways
eoc01120  Microbial metabolism in diverse environments
eoc01220  Degradation of aromatic compounds
Module
eoc_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:eoc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CE10_0319 (mhpF)
   00650 Butanoate metabolism
    CE10_0319 (mhpF)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    CE10_0319 (mhpF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CE10_0319 (mhpF)
   00622 Xylene degradation
    CE10_0319 (mhpF)
   00621 Dioxin degradation
    CE10_0319 (mhpF)
Enzymes [BR:eoc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     CE10_0319 (mhpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh F420_oxidored GFO_IDH_MocA Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: AEQ11163
UniProt: A0A0E0V1S7
Position
355182..356132
Genome map
AA seq 316 aa AA seqDB search
MSKRKVAIIGSGNIGTDLMIKILRHGQHLEMAVMVGIDPQSDGLARARRMGVATTHEGVI
GLMNMPEFADIDIVFDATSAGAHVKNDAALREAKPDIRLIDLTPAAIGPYCVPVVNLEEN
VDQLNVNMVTCGGQATIPMVAAVSRVARVHYAEIIASIASKSAGPGTRANIDEFTETTSR
AIEVVGGAAKGKAIIVLNPAEPPLMMRDTVYVLSDEASQDDIEASINEMAEAVQAYVPGY
RLKQRVQFEVIPQDKPVNLPGVGQFSGLKTAVWLEVEGAAHYLPAYAGNLDIMTSSALAT
AEKMAQSLARKAGEAA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagcgtaaagtcgccattatcggttcaggcaacattggcaccgatctgatgatt
aaaattttgcgtcacggtcagcatctggagatggcggtgatggtcggcattgatcctcag
tccgacggtctggcgcgtgccagacgtatgggcgtcgctaccacccatgaaggggtgatt
gggctgatgaacatgcctgaatttgctgatatcgatatagtgtttgatgcgaccagcgcg
ggcgcgcatgtgaaaaacgatgccgctttgcgcgaagcgaaaccggatattcgcttaatt
gacctgacgcctgctgccatcggcccttactgcgtgccggtggttaacctcgaggagaac
gtcgatcaactgaacgtcaacatggtcacctgcggcggccaggccaccattccaatggtg
gcggcagtttcacgcgtggcgcgtgttcattacgccgaaattatcgcttctattgccagt
aaatctgccggacctggcacgcgtgccaatatcgatgaatttacggaaaccacttcgcgc
gccattgaagtggtgggcggtgcggcaaaagggaaggcgattattgtgcttaacccagca
gagccaccgttgatgatgcgtgacacggtgtatgtattgagcgacgaagcttcacaagat
gatatcgaagcctcaatcaatgaaatggctgaggcggtacaggcttacgtaccgggttat
cgcctgaaacagcgcgtgcagtttgaagttatcccgcaggataaaccggttaatttgccg
ggcgtggggcagttctccgggctgaaaacggcggtctggctggaagtcgaaggcgcagcg
cattatctgcctgcctatgcgggcaacctcgacattatgacttccagtgcgctggcgaca
gcggaaaaaatggctcagtcactggcgcgcaaggcaggagaagcggcatga

DBGET integrated database retrieval system